Synthetic Chemical Pesticides Research Articles

Photocatalytic Degradation of Ethylene Bis-Dithiocarbamate Fungicide from Wastewater Using Cerium Oxide Nanoparticles under Natural Solar Irradiation

This study developed a suitable method for the degradation of ethylene bis-dithiocarbamate pesticide mancozeb in wastewater and agricultural runoff using nanoceria as photocatalysts. The nanoceria or cerium oxide nanoparticles were synthesized using a simple coprecipitation method with cerium nitrate hexahydrate (Ce (NO3)3. 6H2O) and Potassium carbonate (K2CO3) as a precursor and precipitating agent respectively. The synthesized powder particle was further ascertained through characterization using Scanning Electron Microscopy SEM for surface morphology, Fourier Transform Infrared Spectroscopy FTIR for the determination of the functional groups, Powder X-ray diffraction PXRD for crystal structure, phase and crystallite size and Energy Dispersive X-ray Spectroscopy EDAX for elemental composition of the synthesized nanoceria. It was revealed that the nanoparticle was successfully synthesized with a crystallite size of 27 nm. Photocatalytic degradation of mancozeb pesticide using the synthesized NPs was determined in batches with optimization of certain parameters including; the initial concentration of pesticide, quantity of the photocatalyst, irradiation time, calcination temperature and UV index. Nanoceria was found to degrade more than 62% of the initial concentration of mancozeb in 2 hours. Nanoceria usually acts as an active sorbent in the destruction of pesticides in wastewater and as such, its application on the degradation of mancozeb is crucial and significant. This method can be suitable for agricultural runoff and synthetic chemical pesticides effluent with proper optimisation.

In vitro efficacy of plant growth-promoting rhizobacteria isolated from ginger (Zingiber officinale) rhizosphere for biological control of plant pathogens

The excessive use of synthetic chemical pesticides in controlling plant diseases poses significant challenges to sustainable agriculture. As an environmentally friendly alternative, plant growth-promoting rhizobacteria (PGPR) have shown promise by colonizing plant roots and forming symbiotic relationships that enhance plant growth and suppress plant pathogens. Research on the isolation of PGPR from ginger (Zingiber officinale) rhizosphere in Indonesia remains limited, highlighting the need for further exploration to support genetic resource conservation and sustainable agricultural practices. This study aims to evaluate the potential of PGPR isolates from Z. officinale rhizosphere in Semarang, Indonesia, as biological control agents. Isolates were characterized based on morphology, biochemical traits, and their antagonistic activity against fungal pathogens, including Fusarium oxysporum, Colletotrichum sp., and Alternaria sp. A total of 14 isolates were obtained, exhibiting diverse morphological, biochemical, and antagonistic properties. Among them, isolate 235A2 demonstrated the highest potential as a biological control agent, with capabilities including phosphate solubilization, nitrogen fixation, protease enzyme production, and significant inhibition rates of F. oxysporum (13.79%), Colletotrichum sp. (55.56%), and Alternaria sp. (35.61%) in vitro. These findings underscore the potential of PGPR as a sustainable alternative for biological control of plant pathogens, supporting both enhanced plant productivity and environmental conservation.

Managing tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide.

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from Lactiplantibacillus argentoratensis strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato (Solanum lycopersicum) caused by Ralstonia solanacearum. Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.3% and disease severity by 45.8%. Scanning electron microscopy revealed severe morphological disruptions in the bacterial cells upon exposure to the AMP. Additionally, the AMP enhanced host resistance by elevating defense enzyme activities, leading to notable improvements in plant morphology, including a 95.5% increase in plant length, a 20.1% increase in biomass, and a 96.69% increase in root length. This bifunctional AMP provides dual protection by exerting direct antimicrobial activity against the pathogen and eliciting plant defense mechanisms. These findings underscore the potential of this biologically sourced AMP as a natural agent for combating plant diseases and promoting growth in tomato crops. To the best of our knowledge, this is the first study to demonstrate the use of a foliar spray application of a biosynthesized microbial peptide as biocontrol agent against R. solanacearum. This interaction not only highlights its biocontrol efficacy but also its role in promoting the growth of Solanum lycopersicum thereby increasing overall agricultural yield.

Exploring the Role of Endophytes in Cannabis sativa L. Polyploidy and Agricultural Trait Improvement

Here, we examine the effects of ploidy variation in Cannabis sativa L. cell lines on the plant host genotype-associated microbiome. The endophytic microbiome has a protocooperative role in improving plant health and productivity and represents an alternative to synthetic chemical fertilizers and pesticides in sustainable agriculture. This study assessed the effects of seed endophytes on diploid and triploid Haze hemp cultivars. Key phenotypic characteristics were evaluated, revealing significant differences in seed germination in vitro as well as vegetative growth and flowering in phytotron conditions. Endophyte-treated triploid plants exhibited significantly taller heights compared to diploids (p < 0.01). These treated triploid plants also showed longer leaves at nodes 2, 6, and 8, except at node 4, indicating a plant in transition from vegetative growth to the generative developmental stage. Additionally, triploids treated with endophytes displayed the highest number of axillary branches, while endophyte-treated diploids had the fewest (p < 0.05). Both cultivars treated with endophytes exhibited a higher number of inflorescences compared to untreated control plants. This study revealed for the first time a direct correlation between the shifts in diameter of the stem and the biomass in both tested hemp hosts, in association with endophytic microbiomes.

An Ecofriendly Nature-Inspired Microcarrier for Enhancing Delivery, Stability, and Biocidal Efficacy of Phage-Based Biopesticides.

In pursuit of sustainable agricultural production, the development of environmentally friendly and effective biopesticides is essential to improve food security and environmental sustainability. Bacteriophages, as emerging biocontrol agents, offer an alternative to conventional antibiotics and synthetic chemical pesticides. The primary challenges in applying phage-based biopesticides in agricultural settings are their inherent fragility and low biocidal efficacy, particularly the susceptibility to sunlight exposure. This study addresses the aforementioned challenges by innovatively encapsulating phages in sporopollenin exine capsules (SECs), which are derived from plant pollen grains. The size of the apertures on SECs could be controlled through a non-thermal and rapid process, combining reinflation and vacuum infusion techniques. This unique feature facilitates the high-efficiency encapsulation and controlled release of phages under various conditions. The proposed SECs could encapsulate over 9 log PFU g-1 of phages and significantly enhance the ultraviolet (UV) resistance of phages, thereby ensuring their enhanced survivability and antimicrobial efficacy. The effectiveness of SECs encapsulated phages (T7@SECs) in preventing and treating bacterial contamination on lettuce leaves is further demonstrated, highlighting the practical applicability of this novel biopesticide in field applications. Overall, this study exploits the potential of SECs in the development of phage-based biopesticides, presenting a promising strategy to enhancing agricultural sustainability.

Plant Agrobiodiversity, Agricultural and Phytosanitary Practices of Market Garden Crops in the Centre‐East Region of Burkina Faso

ABSTRACTIntroductionIn West Africa, market gardeners use various agricultural practices to increase yields. However, many of these practices do not comply with agroecological standards and cause intoxication, pollution, soil degradation and biodiversity loss. This study characterizes the plant agrobiodiversity of market garden crops grown during the rainy season and the agricultural and phytosanitary practices used for their management.Materials and MethodsThe study was carried out in Burkina Faso. Plant agrobiodiversity was assessed in 100 market gardens. Agricultural and phytosanitary practices were characterized using semi‐structured interviews. A Sankey diagram was used to highlight the relationships among market garden crops, bioaggressors and diseases. Principal component analyses were applied to highlight the agricultural and phytosanitary practices used.ResultsThe results revealed rich agrobiodiversity, including 16 market garden crops, 15 local agroforestry species, 17 planted species and 37 weed species. The main market garden crops grown in the rainy season were cabbage (20.30%), lettuce (16.62%), tomato (11.69%), and amaranth (10.15%). The most frequent agroforestry species were Azadirachta indica (18.20%) and Mangifera indica (15.03%). The most common weeds were Eleusine indica (11.02%) and Cyperus reduncus (9.70%). Eleven pests were identified, and the most frequently recorded were caterpillars (39.06%). Sixteen diseases were reported, the most common being leaf yellowing (15.67%) and leaf wilt (11.67%). Numerous market gardeners use mineral fertilizers such as Yaramila (NPK 23‐10‐5), NPK (14‐23‐14), urea (46.00% nitrogen), and liquid fertilizer as well as compost and organic manure. The most common agricultural practice was crop rotation (79.00%). To protect crops, 89.00% of producers used synthetic chemical pesticides in an uncontrolled manner, most of which are purchased on the local market. Only 11.00% of the market gardeners practiced the natural phytosanitary treatments.ConclusionThis study provides important information that can be used for the sustainable management of market gardens. Agroecological standards should be popularized to ensure food security for market garden crops.

Recent Advances in Biopesticide Formulations for Targeted Insect Pest Management: A Review

The increasing environmental and health concerns associated with the use of synthetic chemical pesticides have driven the need for alternative, eco-friendly pest management solutions. Biopesticides, derived from natural sources such as plants and microorganisms, offer a promising solution, as they are less toxic, decompose quickly, and target specific pests with minimal impact on non-target organisms. Recent advancements in biopesticide formulations, including nano pesticides, controlled release formulations (CRFs), hydrogels, polymer-coated granules, and tablets, are enhancing the effectiveness, stability, and environmental safety of these products. The integration of nanotechnology and controlled release systems in biopesticides is opening new avenues for sustainable agriculture. This review discusses the various biopesticide formulation technologies, highlighting their advantages, disadvantages, and future prospects.

Exploring the Efficacy and Sustainability of Natural Pesticides in Plant Protection

With the increasing demand for sustainable agricultural practices, the efficacy and sustain-ability of natural pesticides in plant protection, providing a critical assessment of their potential as alternatives to synthetic chemical pesticides is the basic demand of the future. This study aimes to examine the diverse categories of natural pesticides, including plant-based, microbial, and mineral-based options, and evaluate their effectiveness against a broad range of pests and diseases. We exam-ine the environmental impact of natural pesticides on non-target organisms, their persistence and degradation, and the potential for bioaccumulation, focusing on their reduced chemical residues and ecological compatibility. Typically, natural pesticides target specific areas of the insect, like its nerv-ous system, leading to the insect's downfall, loss of coordination, paralysis, and eventual death. The majority of botanical pesticides affect the target organism by poisoning its stomach, lungs, or other bodily systems. Sincebotanical pesticides are typically fairly biodegradable and may be quickly bro-ken down by the stomach acids of mammals, their toxicity to humans and animals is typically quite low, and they are environmentally beneficial. Natural pesticides offer significant environmental, health, economic, and social benefits, making them an essential component of modern sustainable agriculture. Their use supports ecological balance, human safety, and long-term agricultural produc-tivity. Overall, it highlights the promising efficacy and sustainability of natural pesticides, underscor-ing their potential for enhancing plant protection while minimizing environmental risks.

Management of Fusarium Wilt of Castor (Ricinus communis L.) Caused by Fusarium oxysporum f.sp. Ricini with Biorationals and Fungicides under In vitro Conditions

To mitigate the harmful effects of synthetic chemical pesticides, eight biorationals i.e ginger, onion, bougainvillea, garlic, chili, turmeric, neem, and aloe vera were tested at different test concentrations of 10%, 15%, and 20% against Fusarium oxysporum f. sp. ricini, the pathogen causing wilt in castor. Among all the tested biorationas, chilli found as most effective while aloe vera showed the least pathogen suppression. The study recommended neem and chili as effective biorationals against F. oxysporum f. sp. ricini. New fungicide combinations i.e Picoxystrobin + Tricyclazole, Fluopyram + Tebuconazole, Boscalid + Pyraclostrobin, and Iprovalicarb + Propineb were tested under in vitro condition out of which Picoxystrobin + Tricyclazole and the standard fungicides Carbendazim and Thiophanate-methyl showed cent percent inhibition at all tested concentrations (500, 1000, 1500 and 2000 ppm). Fluopyram + Tebuconazole and Boscalid + Pyraclostrobin also showed high efficacy, while Iprovalicarb + Propineb was the least effective. The study revealed that neem and chili are recommended as effective biorationals against F. oxysporum f. sp. ricini. Among fungicides, Picoxystrobin + Tricyclazole proved most effective, suggesting its potential for managing castor wilt.

Development of an agroinfiltration-based transient hairpin RNA expression system in pak choi leaves (Brassica rapa ssp. chinensis) for RNA interference against Liriomyza sativae

The vegetable leafminer (Liriomyza sativae) is a devastating invasive pest of many vegetable crops and horticultural plants worldwide, causing serious economic loss. Conventional control strategy against this pest mainly relies on the synthetic chemical pesticides, but widespread use of insecticides easily causes insecticide resistance development and is harmful to beneficial organisms and environment. In this context, a more environmentally friendly pest management strategy based on RNA interference (RNAi) has emerged as a powerful tool to control of insect pests. Here we report a successful oral RNAi in L. sativae after feeding on pak choi (Brassica rapa ssp. chinensis) that transiently express hairpin RNAs targeting vital genes in this pest. First, potentially lethal genes are identified by searching an L. sativae transcriptome for orthologs of the widely used V-ATPase A and actin genes, then expression levels are assessed during different life stages and in different adult tissues. Interestingly, the highest expression levels for V-ATPase A are observed in the adult heads (males and females) and for actin in the abdomens of adult females. We also assessed expression patterns of the target hairpin RNAs in pak choi leaves and found that they reach peak levels 72 h post agroinfiltration. RNAi-mediated knockdown of each target was then assessed by letting adult L. sativae feed on agroinfiltrated pak choi leaves. Relative transcript levels of each target gene exhibit significant reductions over the feeding time, and adversely affect survival of adult L. sativae at 24 h post infestation in genetically unmodified pak choi plants. These results demonstrate that the agroinfiltration-mediated RNAi system has potential for advancing innovative environmentally safe pest management strategies for the control of leaf-mining species.

'The Garlic Gambit': an alternative strategy for controlling vine weevil (Otiorhynchus sulcatus F.; Coleoptera: Curculionidae).

Plant protection products derived from plant material are proposed to be a sustainable alternative to conventional synthetic chemical pesticides. This study determines the efficacy of a commercially available bioinsecticide based on garlic (Allium sativum L.; Asparagales: Amaryllidaceae) extract against vine weevil (Otiorhynchus sulcatus F.; Coleoptera: Curculionidae) eggs and larvae in contact, fumigation and a combination of contact and fumigation bioassays under laboratory conditions. Results showed that garlic significantly reduced egg hatch rate compared to the control group when applied as a fumigant. Similarly, the egg hatch rate was reduced compared to the control group when garlic was applied as combined contact and fumigant applications. No effect was observed when the garlic product was applied as a contact application. The bioinsecticide significantly reduced larval survival when either contact or fumigant applications were used. A combined contact and fumigant effect was shown also when vine weevil eggs were exposed to the bioinsecticide for 30 days in plastic containers containing growing media. The number of larvae recovered after this period was significantly reduced compared to the control group. This study demonstrates the potential of garlic-based bioinsecticides, such as Pitcher GR, for vine weevil control. Further studies are, however, needed to determine the efficacy of such bioinsecticides under field conditions and investigate how these products can be most effectively used as a part of a wider vine weevil integrated pest management program.

Seed extracts as an effective strategy in the control of plant pathogens: Scalable industry bioactive compounds for sustainable agriculture

With a growing global population, maintaining sufficient agricultural production is crucial. However, agriculture faces numerous challenges today, particularly due to the undeniable impacts of climate change, which are expected to intensify pest and disease pressures. The traditional approach to combat these phytopathological issues has relied on synthetic chemical pesticides. While their use has indeed increased productivity, it is also evident their detrimental and cumulative effects on the environment, and the current negative perception of the population toward these chemicals. In response, governments are prompting the search for alternatives to synthetic pesticides, through different policies, such as the strategy From Farm to Fork in the European Union, which aims to reduce the use of chemical pesticides by 50% by 2030, among other measures. At this point, seed extracts with biocidal activity are emerging as a viable option for the control and management of various pathogenic agents, such as harmful bacteria, fungal and oomycete pathogens, and plant-parasitic nematodes. Nevertheless, it is worth mentioning that most of the studies have been only conducted under highly controlled conditions. Thus, this line of research should be still more deeply developed, including proofs under field conditions, in order to become the extensive and widespread use of these bio-products a reality. In this review, we compile the main studies focused on the use of these compounds for phytosanitary purposes, describing and analysing the key metabolites, their composition, extraction processes and the mechanisms involved in their antagonistic effects. Additionally, we analyse the primary factors contributing to the limited adoption of these extracts in the field, such as the scarcity of studies under real conditions or the possible impact on non-target organisms, and discuss future prospects for their development.

ETUDE DE LEFFICACITE DES BIOPESTICIDES A BASE DE GRAINESDE NEEM ET DELENTOMOPATHOGENEBEAUVERIABASSIANA(BALS.) VUILL.POUR LA GESTION DES PRINCIPAUX INSECTES RAVAGEURS DE LA CULTURE DU NIEBE DANS LA REGION DE MARADI AU SAHEL

The insect pests of cowpea, Vignaunguiculata L. Walper, is one of the constraints which affect the cultivation this crop in Africa. The pod sucking bug Clavigrallatomentosicollis(Stål), the flower thripsMegallurothripssjöstedti(Trybom) and the pod borer Marucavitrata(Fabricius) are the main insect pests whose damage causes considerable yield losses on cowpea crop. In this study, neem Azadirachtaindica based biopesticides and the entomopathogenBeauveriabassiana(Bals.) Vuill were tested todeterminetheir efficiency in the management of cowpea insect pests. The trials were established in a farming environment with producers in 15 villages of the Maradiregion during three consecutive cropping seasons 2020, 2021 and 2022. The experimental design is the Fisher block with 4 treatments (Neem grain, B. bassiana, Chemical pesticide and the control without treatment) and two repetitions per site. The results for this studybiopesticide treatments (Neem grains and entomopathicfungus B. bassiana) reduced the insect pest damageof 73.21% and a yields increase of 104.12% compared to the control treatment. . Neem was effective as the synthetic chemical pesticide in the management of insect pests as it reduced the populations of M. sjöstedti, M. vitrata and C. tomentosicollis by 67.29, 70.57 and 71.26%respectively. This Neem biopesticide resulted a yield increase of 140.33% on cowpea for the three years of the study. Thus, for low-income producers, neem is an available resource that can constitute an effective and ecological alternative for managing cowpea insect pests in the Sahel.

Volatile Organic Compound Emission Inventory for Pesticide Spraying in an Agricultural City of Northeast China: Real-Time Monitoring and Method Optimization

Atmospheric volatile organic compounds (VOCs), such as olefins and aromatics, released from synthetic chemical pesticide sprays can increase regional air pollution, public health risks, and food security risks. However, significant uncertainties remain regarding the measurement methods and chemical profiles of VOC emissions. Using an agricultural city, Changchun City in Northeast China, as a case study, we quantified real-time concentration and composition data based on online monitoring instruments for the year 2023. This study optimized data collection methods for emission factors and activity levels and developed a high-precision emission inventory of VOCs in pesticides at the city scale. The emission factors for VOCs from the seven categories of pesticides were estimated as follows: 78 g/kg (nicosulfuron and atrazine, oil-dispersible [OD] and suspension emulsion [SE], respectively), 4 g/kg (chlorpyrifos and indoxair conditioningarb, suspension concentrate [SC]), 5 g/kg (fluopicolide and propamocarb hydrochloride, SC), 217 g/kg (MCPA-dimethylammonium, aqueous solution [AS]), 34 g/kg (glyphosate, AS), 575 g/kg (beta-cypermethrin and malathion, emulsifiable concentrate [EC]), and 122 g/kg (copper abietate, emulsion in water [EW]), depending on the pesticide formulation components and formulation types. The orchard insecticide exhibited the highest emission factors among all pesticides owing to its emulsifiable concentrate formulation and 80% content of inactive ingredients (both factors contribute to the high content of organic solvents in the pesticide). The major components of VOC emissions from pesticide spraying were halocarbons (27–44%), oxygenated VOCs (OVOCs) (25–38%), and aromatic hydrocarbons (15–28%). The total VOC emissions from pesticide spraying in the Changchun region accounted for 10.6 t, with Yushu City contributing 28% of the VOC emissions and Gongzhuling City and Dehui City contributing 18.7% and 16.0%, respectively. Herbicides were the main contributors to VOC emissions because of their high emission factors and extensive use in fields (used for spraying maize and rice, the main crops in Changchun City). May and June exhibited the highest VOC emissions from pesticide application, with May accounting for 57.0% of annual pesticide emissions, predominantly from herbicides (95.1%), followed by insecticides (4.9%). June accounted for 30.1% of the annual pesticide emissions, with herbicides being the largest contributor of VOC emissions. An emission inventory of VOC with a monthly scale and spatial grid resolutions of 0.083° and 0.5° in 2023 was developed. These emission factors and inventories of pesticide applications provide valuable information for air quality modeling. This study also provides an important scientific basis for enhancing regional air quality and mitigating the environmental impact of pesticide use in major grain-producing areas.

Actinobacteria mediated synthesis of silver nanoparticles using Streptomyces diastaticus and their biological efficacy against human vector mosquitoes and agricultural insect pests

Mosquitoes and agricultural insects were harmful to both public health and crops. Prolonged use of synthetic chemical pesticides for insect pest control was associated with resistance development and negative human and ecological effects. This study investigates the larvicidal activity of Ag-NPs produced using Streptomyces diastaticus against Culex quinquefasciatus, Anopheles stephensi, Aedes aegypti, Spodoptera litura, and Plutella xylostella. UV-Vis spectroscopy, XRD, SEM-EDX, FT-IR, TEM, DLS, and Zeta potential analysis were used to characterize the biosynthesized Ag-NPs. The results showed that biosynthesized Ag-NPs were more toxic to, A. stephensi, C. quinquefasciatus, and A. aegypti with LC50 values of 15.70, 11.10, and 17.53 µg/mL, respectively. Biosynthesized Ag-NPs exhibited the highest antifeedant effects against S. litura (88.73 %) and P. xylostella (92.36 %) at 50 µg/mL concentration. The mortality bioassay revealed considerable larvicidal activity against S. litura and P. xylostella larvae at greater doses of 50 µg/mL, 80.67 and 84.05 %, respectively. Morphogenetic variations were observed on treated larvae of C. quinquefasciatus, A. aegypti, and A. stephensi, S. litura, and P. xylostella with Ag-NPs. In the present investigation the impact of Ag-NPs on the antioxidant enzymes (SOD, CAT, and GPx), the activity of each enzyme were dramatically increased with higher concentrations resulting in significant differences. The study also found that Ag-NPs inhibited the detoxifying enzyme (GST and AChE) activity of target organisms. The histological structure of the treated and untreated larvae revealed structural changes between the midgut epithelial cells. As a consequence of these findings, the S. diastaticus-mediated Ag-NPs serve as a possible, eco-friendly biopesticide and alternative to synthetic chemicals for the control of human vector mosquitoes and destructive arthropod insect pests.

Pengendalian Terpadu Hama dan Penyakit Tanaman Semusim di Desa Tanjung Seteko Kecamatan Indralaya Kabupaten Ogan Ilir

In the North Indralaya sub-district, annual crop agriculture, including annuals, melons, and watermelons, relies on conventional cultivation methods using expensive synthetic chemical fertilizers and pesticides to enhance production and combat pests and diseases. This community service initiative aims to educate and implement integrated control practices for sustainable annual crop cultivation while providing knowledge on pest and disease management in Tanjung Seteko Village, Indralaya District, Ogan Ilir Regency. The project, part of Sriwijaya University's integrated community service program, seeks to transform the village into a vegetable center in Ogan Ilir. The activities involve socializing integrated control methods through focused group discussions, practical sessions on biostimulant preparation, and field application. Farmers actively participate, posing questions about optimal annual crop cultivation and integrated control solutions. Preliminary results indicate that combining biostimulants with integrated control effectively manages pests and plant diseases. Continued intensive support aims to enable farmers in Tanjung Seteko village to adopt integrated control practices successfully, contributing to the village's potential as a vegetable center in Ogan Ilir.

Reduction potentials of chemical-synthetic pesticides – A case study using the example of an Eco-Scheme in southern Germany

Chemical-synthetic pesticides (CSPs) are associated with several negative environmental effects. The European Commission aims to reduce their use by 50% by 2030. This paper looks at the German Eco-Scheme, an agri-environmental payment scheme, for the foregoing of chemical-synthetic pesticides (CSPs) in arable crops for a one-year period. Using Baden-Württemberg in southern Germany as a case study, we investigated the suitability of the Eco-Scheme as a policy tool for CSP reduction. We used a field-based, georeferenced integrated land use model based on linear programming. Different payment levels for the Eco-Scheme were simulated. In addition, we analyzed the effect of labor availability, crop yield requirements, and market prices on Eco-Scheme implementation (uptake).The implementation potentials at €130/ha, the payment level in 2023, were limited and strongly dependent on market prices as well as potential food supply targets. The percentage decline in overall CSP use (measured in active substance mass) was even lower than the implementation in the percentage of acreage attributed to the Eco-Scheme. The implementation potentials were mainly observed on marginal sites. Higher simulated payment levels led to lower cost efficiency and dead weight losses. This trade-off between cost efficiency and effective reduction questions the suitability of the Eco-Scheme, at least for more substantial CSP reductions. To increase economic efficiency, we recommend differentiating payments based on abatement costs, for example on a crop-basis.

Advancing Sustainable Agriculture: A Comprehensive Review of Organic Farming Practices and Environmental Impact

Organic farming, characterized by the exclusion of synthetic fertilizers and chemical pesticides, represents a sustainable approach to agriculture. This study investigates the impact of organic farming practices on soil health, focusing on the proliferation and activity of soil microorganisms. Natural fertilizers such as farmyard manure, poultry litter, composts, green manures, and oil-free cakes were utilized to enhance soil fertility. The research reveals that these practices significantly improve soil health by fostering a robust microbiome, which is essential to the cycling of nutrients and overall health of the soil vitality. The safety and nutritional benefits of organic food products were also evaluated. Comparative analysis with conventionally grown foods indicates that organic produce contains lower levels of harmful residues such as pesticides, nitrates, metals, and antibiotics. This reduction in contaminants mitigates potential risks to human health associated with conventional farming practices. Furthermore, organic foods are found to be richer in essential nutrients, vitamins, and antioxidants, thereby offering superior nutritional value. The economic implications of organic farming were explored, highlighting its potential to enhance the economic viability of small-scale farmers. With increasing consumer awareness and demand for organic products, farmers practicing organic methods can command higher prices for their produce, thereby improving their economic sustainability and resilience. In conclusion, organic farming emerges as an environmentally friendly and economically viable alternative to conventional agriculture. By promoting soil health, reducing chemical residues in food, and meeting consumer demand for nutritious products, organic farming offers a pathway towards sustainable agricultural practices.

Molecular Characterization Reveals Biodiversity and Biopotential of Rhizobacterial Isolates of Bacillus Spp

Bacillus species appearas the most attractive plant growth-promoting rhizobacteria (PGPR) and alternative to synthetic chemical pesticides. The present study examined the antagonistic potential of spore forming-Bacilli isolated from organic farm soil samples of Allahabad, India. Eighty-seven Bacillus strains were isolated and characterized based on their morphological, plant growth promoting traits and molecular characteristics. The diversity analysis used 16S-rDNA, BOX-element, and enterobacterial repetitive intergenic consensus. Two strains, PR30 and PR32, later identified as Bacillus sp., exhibited potent in vitro antagonistic activity against Ralstonia solanaceorum. These isolates produced copious amounts of multiple PGP traits, such as indole-3-acetic acid (40.0 and 54.5 μg/mL), phosphate solubilization index (PSI) (4.4 and 5.3), ammonia, siderophore (3 and 4 cm), and 1-aminocyclopropane-1-carboxylate deaminase (8.1and 9.2 μM/mg//h) and hydrogen cyanide. These isolates were subjected to the antibiotic sensitivity test. The two potent isolates based on the higher antagonistic and the best plant growth-promoting ability were selected for plant growth-promoting response studies in tomatoe, broccoli, and chickpea. In the pot study, Bacillus subtilis (PR30 and PR31) showed significant improvement in seed germination (27–34%), root length (20–50%), shoot length (20–40%), vigor index (50–75%), carotenoid content (0.543–1.733), and lycopene content (2.333–2.646 mg/100 g) in tomato, broccoli, and chickpea. The present study demonstrated the production of multiple plant growth-promoting traits by the isolates and their potential as effective bioinoculants for plant growth promotion and biocontrol of phytopathogens.

Using predatory species and entomopathogenic fungi as alternatives to chemical pesticides in green bean field

BackgroundGreen bean, Phaseolus vulgaris L. (Fam.: Leguminosae) is a widely consumed grain legume prized for its edible seeds and pods. It is susceptible to infestations with various pests as insects and mites throughout the growing season. In this study, the efficacy of the predatory species, Chrysoperla carnea (Stephens), Phytoseiulus persimilis Athias-Henriot and the entomopathogenic fungus (EPF) Metarhizium anisopliae (Hypocreales: Clavicipitaceae), as well as conventional pesticides, Mospilan and Vertimec, were evaluated against the most important pests, mainly the whitefly, Bemisia tabaci (Genn.) and the two-spotted spider mite, Tetranychus urticae Koch, infesting the green beans cultivated at two locations Giza and El-Menoufia Governorates in Egypt.ResultsThe findings demonstrate that treatments using C. carnea and M. anisopliae effectively reduced the whitefly population, while pesticide treatments were comparatively less effective. In the Giza plots, at the end of the experiments, the use of both M. anisopliae and C. carnea showed high reductions in whitefly population (85.57 and 84.87%), respectively, while in El-Menoufia, C. carnea (97.74%) was the most effective treatment followed by M. anisopliae (90.32%). Pesticide treatment in this case yielded a reduction rate of (22.76 and 59.67%) in Giza and El-Menoufia plots, respectively. However, for spider mite control, P. persimilis proved to be the most effective treatment in Giza and El-Menoufia plots, reducing the spider mite population to 98.44 and 96.14%, respectively. Metarhizium anisopliae treatment also displayed moderate effectiveness, with reduction rates of 75.62 and 75.37% in Giza and El-Menoufia plots, respectively. In comparison, pesticide treatment showed low effectiveness, with reduction rates of only 23.92 and 53.16% in the two locations, respectively.ConclusionApplications of the predator, C. carnea and the EPF, M. anisopliae were highly effective in reducing the population of whitefly, while the predator mite P. persimilis proved to be the most effective for controlling the spider mites. Overall, the study suggests that biocontrol agents, such as the predators and the EPF, can be considered as alternatives to synthetic chemical pesticides for controlling pests infesting green beans.