Brain-subesophageal Ganglion Research Articles

Brain-midgut cross-talk and autocrine metabolastat via the sNPF/CCAP negative feed-back loop in the American cockroach, Periplaneta americana.

Immunohistochemical reactivities against short neuropeptide F (sNPF-ir) and crustacean cardioactive peptide (CCAP-ir) were detected in both the brain-subesophageal ganglion (Br-SOG) and midgut epithelial cells of the male American cockroach, Periplaneta americana. Four weeks of starvation increased the number of sNPF-ir cells and decreased the CCAP-ir cells in the Br-SOG, whereas refeeding reversed these effects. The contents of sNPF in the Br-SOG, midgut and hemolymph titer decreased in response to an injection of CCAP into the hemocoel of normally fed male cockroaches, while CCAP titers/contents decreased in response to an injection of sNPF. The results of a double-labeling experiment demonstrated that sNPF-ir co-existed in CCAP-ir cells in the pars intercerebralis (PI), dorsolateral region of protocerebrum (DL), deutocerebrum (De) and SOG. sNPF-ir and CCAP-ir were also colocalized in the midgut. sNPF and CCAP are neuropeptides and midgut factors that interact with each other. Since the two peptides are known to be secreted by identical cells that affect each other, this constitutes autocrine negative feedback regulation for a quick response to food accessibility/inaccessibility. These peptides not only constitute the switch in the digestive mechanism but also couple digestive adaptation with behavior. A CCAP injection suppressed locomotor activity when cockroaches were starved, whereas sNPF activated it when they were fed.

Distribution of Short Neuropeptide F-like Immunohistochemical Reactivity in the Brain and Midgut of the Terrestrial Isopod, <i>Armadillidium vulgare</i> (Latreille)

Immunohistochemical reactivity against short neuropeptide F (sNPF-ir) was detected in both the brain–subesophageal ganglion (Br-SOG) and midgut epithelial cells of the isopod, Armadillidium vulgare. More than 194 cell bodies showed immunohistochemical reactivity in the brain and SOG. A wide distribution of sNPF-ir occured in the optic lobe (OL; 82 cells), accessory lobe (AL; 56 cells), central body (CB), tritocerebrum (Tr; 18 cells), circumesophageal connective (COMI; 7 cells), and subesophageal mass (SOG; 25 cells), while no sNPF-ir was observed in the deutocerebrum (DC) and pseudofrontal organ (PFO). sNPF-ir was also detected in both paraneuronal cells and stomatogastric nerve elements in the midgut muscle layer. Immunostaining of cells in the Br-SOG and midgut was blocked by preabsorption test. No difference was found in number or distribution of sNPF-ir between males and females. sNPF is both neuropeptide and midgut factors. This wide distribution suggests that sNPF may not only coordinate feeding and digestion in A. vulgare but also support multiple functions.

CDNA CLONING AND SEQUENCE DETERMINATION OF THE PHEROMONE BIOSYNTHESIS ACTIVATING NEUROPEPTIDE FROM THE SEABUCKTHORN CARPENTERWORM, Holcocerus hippophaecolus (LEPIDOPTERA: COSSIDAE)

The PBAN (pheromone biosynthesis activating neuropeptide)/pyrokinin peptides comprise a major neuropeptide family characterized by a common FXPRL amide at the C-terminus. These peptides are actively involved in many essential endocrine functions. For the first time, we reported the cDNA cloning and sequence determination of the PBAN from the seabuckthorn carpenterworm, Holcocerus hippophaecolus, by using rapid amplification of cDNA ends. The full-length cDNA of Hh-DH-PBAN contained five peptides: diapause hormone (DH) homolog, α-neuropeptide (NP), β-NP, PBAN, and γ-NP. All of the peptides were amidated at their C-terminus and shared a conserved motif, FXPR (or K) L. Moreover, Hh-DH-PBAN had high homology to the other members of the PBAN peptide family: 56% with Manduca sexta, 66% with Bombyx mori, 77% with Helicoverpa zea, and 47% with Plutella xylostella. Phylogenetic analysis revealed that Hh-DH-PBAN was closely related to PBANs from Noctuidae, demonstrated by the relatively higher similarity compared with H. zea. In addition, real-time quantitative PCR (qRT-PCR) analysis showed that Hh-DH-PBAN mRNA expression peaked in the brain-subesophageal ganglion (Br-SOG) complex, and was also detected at high levels during larval and adult stages. The expression decreased significantly after pupation. These results provided information concerning molecular structure characteristics of Hh-DH-PBAN, whose expression profile suggested that the Hh-DH-PBAN gene might be correlated with larval development and sex pheromone biosynthesis in females of the H. hippophaecolus.

Changes in the expression and current of the Na+/K+ pump in the snail nervous system after exposure to static magnetic field

Compelling evidence supports the use of a moderate static magnetic field (SMF) for therapeutic purposes. In order to provide insight into the mechanisms underlying SMF treatment, it is essential to examine the cellular responses elicited by therapeutically applied SMF, especially in the nervous system. The Na(+)/K(+) pump, by creating and maintaining the gradient of Na(+) and K(+) ions across the plasma membrane, regulates the physiological properties of neurons. In this study, we examined the expression of the Na(+)/K(+) pump in the isolated brain-subesophageal ganglion complex of the garden snail Helix pomatia, along with the immunoreactivity and current of the Na(+)/K(+) pump in isolated snail neurons after 15 min exposure to a moderate (10 mT) SMF. Western blot and immunofluorescence analysis revealed that 10 mT SMF did not significantly change the expression of the Na(+)/K(+) pump α-subunit in the snail brain and the neuronal cell body. However, our immunofluorescence data showed that SMF treatment induced a significant increase in the Na(+)/K(+) pump α-subunit expression in the neuronal plasma membrane area. This change in Na(+)/K(+) pump expression was reflected in pump activity as demonstrated by the pump current measurements. Whole-cell patch-clamp recordings from isolated snail neurons revealed that Na(+)/K(+) pump current density was significantly increased after the 10 mT SMF treatment. The SMF-induced increase was different in the two groups of control snail neurons, as defined by the pump current level. The results obtained could represent a physiologically important response of neurons to 10 mT SMF comparable in strength to therapeutic applications.

Involvement of Na+/K+pump in fine modulation of bursting activity of the snail Br neuron by 10 mT static magnetic field

The spontaneously active Br neuron from the brain-subesophageal ganglion complex of the garden snail Helix pomatia rhythmically generates regular bursts of action potentials with quiescent intervals accompanied by slow oscillations of membrane potential. We examined the involvement of the Na(+)/K(+) pump in modulating its bursting activity by applying a static magnetic field. Whole snail brains and Br neuron were exposed to the 10-mT static magnetic field for 15min. Biochemical data showed that Na(+)/K(+)-ATPase activity increased almost twofold after exposure of snail brains to the static magnetic field. Similarly, (31)P NMR data revealed a trend of increasing ATP consumption and increase in intracellular pH mediated by the Na(+)/H(+) exchanger in snail brains exposed to the static magnetic field. Importantly, current clamp recordings from the Br neuron confirmed the increase in activity of the Na(+)/K(+) pump after exposure to the static magnetic field, as the magnitude of ouabain's effect measured on the membrane resting potential, action potential, and interspike interval duration was higher in neurons exposed to the magnetic field. Metabolic pathways through which the magnetic field influenced the Na(+)/K(+) pump could involve phosphorylation and dephosphorylation, as blocking these processes abolished the effect of the static magnetic field.

Expression of pheromone biosynthesis activating neuropeptide and its receptor (PBANR) mRNA in adult female Spodoptera exigua (Lepidoptera: Noctuidae)

The full-length cDNA of pheromone biosynthesis activating neuropeptide receptor (PBANR) was cloned from the beet armyworm, Spodoptera exigua (Hübner) (Lepidoptera: Noctuidae); it included an open reading frame of 1,053 bp encoding 350 amino acids. The PBANR of S. exigua (SePBANR) was structurally characteristic of G protein-coupled receptor and its amino acid sequence shared 98% identity with the PBANR of Spodoptera littoralis. Both pheromone biosynthesis activating neuropeptide (PBAN) and PBANR mRNA abundance were measured in the brain-subesophageal ganglion complex, pheromone gland, ventral nerve cord, and ovary of S. exigua female moths by real-time RT-PCR. The abundance of PBAN mRNA in brain-subesophageal ganglion complex and PBANR mRNA in pheromone gland was significantly greater compared to other tissues, suggesting that the ligand-receptor relationship of PBAN and PBANR exists quantitatively in S. exigua. Both PBAN and PBANR expression displayed a remarkable diurnal rhythm, for they were low and stable during the photophase (07:00-21:00) and increased markedly during the scotophase (with a maximum abundance at 23:30) in 3-day-old female moths. The abundance of PBAN and PBANR increased steadily from the 1st day to the 5th day of the adult female life. The pattern of both diurnal and daily expression of PBAN and PBANR mRNA were coincident with enhanced capacity of sex pheromone release and mating of S. exigua moths during the same period. We infer from these results that pheromone biosynthesis and release in S. exigua is regulated by PBAN via up-regulating synthesis.

Novel gene encoding precursor protein consisting of possible several neuropeptides expressed in brain and frontal ganglion of the silkworm, Bombyx mori

A novel gene ( BmK5) expressed in the central nervous system of the silkworm, Bombyx mori, was isolated using a cDNA subtraction method. BmK5 was first cloned as a candidate regulator of diapause hormone release from subesophageal ganglion via corpus cardiacum–corpus allatum into the hemolymph; however, subsequent analyses revealed that the gene expression patterns in brain–subesophageal ganglion complexes did not differ between diapause and nondiapause egg producers. The deduced amino acid sequence showed the characteristics of secretory protein precursor or nuclear localization protein. Immunohistochemical experiments with an anti-BmK5 antibody revealed that BmK5 precursor protein exists in the cytoplasm of specific cells of brain and frontal ganglion, but not in the nuclei. In addition, a peptide (GSGTKVGGAGAATKVVTKSGS-NH 2) possibly processed from the BmK5 precursor protein was immunohistochemically detected in the axons connecting the anti-BmK5 antibody-positive cells to the neurohemal organ, corpus cardiacum–corpus allatum. These results suggest that BmK5 encodes a precursor of the novel neurosecretory protein and that several mature peptides are released into the hemolymph via the corpus cardiacum–corpus allatum, although the functions of these peptides are yet unclear.

PBAN/pyrokinin peptides in the central nervous system of the fire ant, Solenopsis invicta

The pyrokinin/pheromone-biosynthesis-activating neuropeptide (PBAN) family of peptides found in insects is characterized by a 5-amino-acid C-terminal sequence, FXPRLamide. The pentapeptide is the active core required for diverse physiological functions, including the stimulation of pheromone biosynthesis in female moths, muscle contraction, induction of embryonic diapause, melanization, acceleration of puparium formation, and termination of pupal diapause. We have used immunocytochemical techniques to demonstrate the presence of pyrokinin/PBAN-like peptides in the central nervous system of the fire ant, Solenopsis invicta. Polyclonal antisera against the C-terminal end of PBAN have revealed the location of the peptide-producing cell bodies and axons in the central nervous system. Immunoreactive material is detectable in at least three groups of neurons in the subesophageal ganglion and corpora cardiaca of all adult sexual forms. The ventral nerve cord of adults consists of two segmented thoracic ganglia and four segmented abdominal ganglia. Two immunoreactive pairs of neurons are present in the thoracic ganglia, and three neuron pairs in each of the first three abdominal ganglia. The terminal abdominal ganglion has no immunoreactive neurons. PBAN immunoreactive material found in abdominal neurons appears to be projected to perisympathetic organs connected to the abdominal ganglia. These results indicate that the fire ant nervous system contains pyrokinin/PBAN-like peptides, and that these peptides are released into the hemolymph. In support of our immunocytochemical results, significant pheromonotropic activity is found in fire ant brain-subesophageal ganglion extracts from all adult fire ant forms (queens, female and male alates, and workers) when extracts are injected into decapitated females of Helicoverpa zea. This is the first demonstration of the presence of pyrokinin/PBAN-like peptides and pheromonotropic activity in an ant species.

Expression of mRNAs for trehalase-1 and -2 in Brain-Subesophageal Ganglion during Pupal-Adult Development of the Silkworm, Bombyx mori

Expression of mRNAs for trehalase-1 and -2 in Brain-Subesophageal Ganglion during Pupal-Adult Development of the Silkworm, Bombyx mori

Co-localization and unique distributions of two clock proteins CYCLE and CLOCK in the cephalic ganglia of the ground cricket, Allonemobius allardi

CYCLE (CYC) and CLOCK (CLK) are transcriptional activators of the circadian clock genes, period (per) and timeless (tim), binding at E-boxes of their upstream regulatory region in Drosophila. CYC-like and CLK-like immunohistochemical reactivities (CYC-ir and CLK-ir) were investigated in the ground cricket, Allonemobius allardi, in which immunohistochemical reactivities for three circadian clock proteins (PERIOD, Doubletime, and Cryptochrome), two neuropeptides (crustacean cardioactive peptide and diapause hormone), and arylalkylamine-N-acetyltransferase had previously been mapped in the brain-subesophageal ganglion (SOG) complex. CYC-ir and CLK-ir occurred predominantly in the cytoplasm of the neurons distributed mainly in the central brain, SOG, and corpora cardiaca. Double-labeling experiments showed that CYC-ir and CLK-ir were co-localized only in the mandibular and maxillary neuromeres of the SOG. The neuronal processes in the dorsolateral region of the protocerebrum partially shared the immunoreactivities, whereas most of the other immunoreactivities were unique. The optic lobe showed reactivity to anti-CYC at small proximal frontodorsal cells and to anti-CLK at small proximal frontoventral cells. The frontal ganglion exhibited CYC-ir in the cell bodies that lacked CLK-ir. No difference in their number, distribution, or staining intensity was found between sampling under light:dark regimes of 16:8 and 12:12. The levels of both CYC-ir and CLK-ir showed no oscillation throughout a 24-h period. The co-localization pattern suggests that the midline cells of the SOG share most of the circadian-related immunoreactivities, thus constituting the heart of the circadian clock in A. allardi.

Hormonal Control of the Orange Coloration of Diapause Pupae in the Swallowtail Butterfly, Papilio xuthus L. (Lepidoptera: Papilionidae)

Diapause pupae of Papilio xuthus show color polymorphism, represented by diapause-green, orange, and brownish-orange types that are each associated with specific pupation sites. We investigated the role of the site of pupation on the induction of the development of orange types (or brownish-orange types), and the endocrine mechanism underlying the control of color polymorphism in short-day pupae. All short-day larvae of the wandering stage developed into orange or brownish-orange type pupae when they were placed in rough-surfaced containers after gut-purge. Utilizing a pharate pupal ligation between the thorax and abdomen, the endocrine mechanism underlying the control of color polymorphism was shown to involve a head-thorax factor (Orange-Pupa-Inducing Factor: OPIF) that induced orange types in short-day pupae. OPIF was bioassayed using the ligated abdomens of short-day pharate pupae. OPIF was extractable with 2% NaCl solution from 5th-instar larval ganglia complexes following the mesothoracic complex (TG(2,3)-AG(1-7)), but it could not be extracted with either acetone or 80% ethanol solution. OPIF may not exist in the brains of day-0 pupae or in brain-subesophageal ganglion and prothoracic ganglion complexes of 5th-instar larvae. The short-day pharate pupae responded to OPIF in a dose-dependent manner.

Structural characterization and expression analysis of prothoracicotropic hormone in the corn earworm, Helicoverpa zea

The cDNA encoding prothoracicotropic hormone (PTTH), the brain neuropeptide that stimulates the prothoracic glands to synthesize ecdysone, was cloned from the corn earworm Helicoverpa zea (Hez). The amino acid sequence deduced from the cDNA indicates a molecular structure that is distinct from the PTTH’s reported in other Lepidoptera, but all contain an identical proteolytic cleavage site and the seven cysteine residues that are essential for activity. Northern hybridization shows a single mRNA present in the brain–subesophageal ganglion complex. Using RT–PCR, we observed constant amounts of PTTH mRNA during larval development but large fluctuations at pupation and prior to adult eclosion.

Changes in brain monoamine contents in diapause pupae of Antheraea pernyi when activated under long-day and by chilling

The contents of biogenic monoamines in the brain–subesophageal ganglion complex were measured in both bivoltine and univoltine strains of the Chinese oak silkmoth, Antheraea pernyi using HPLC-ECD. The contents in the bivoltine strain were monitored every five days under LD 12:12 and 16:8, photoperiods maintaining and terminating diapause, respectively at 25°C. The univoltine strain was chilled at 2°C and the monoamine contents were measured at 10-day intervals. Dopamine, norepinephrine and epinephrine-like peaks were detected from the crude homogenate and the eluate from the alumina oxide column. The contents of both dopamine and epinephrine-like compounds dropped significantly before the ecdysteroid surge at LD 16:8 and steadily decreased during cold storage. In contrast, 5-HT increased sharply in parallel with the surge of ecdysteroid. Cold storage also strongly affected indolamine metabolism. After cold storage, 5-HT was more predominantly metabolized by N-acetyltransferase than by monoamine oxidase, since 5-HIAA dropped significantly, while N-acetylserotonin increased during cold storage. A dual regulatory system consisting of the ecdysiotropin inhibitory pathway by catecholamaine metabolism and the ecdysiotropin stimulatory pathway by indolamine metabolism is proposed for the regulation of pupal diapause in this species.

Evidence for the Presence of the Summer-Morph-Producing Hormone in the Swallowtail Butterfly, Papilio xuthus L. (Lepidoptera: Papilionidae)

The swallowtail butterfly, Papilio xuthus L., exhibits seasonal diphenism, i.e., spring and summer morphs, the development of which is determined by photoperiod and temperature imposed during the larval stage. Larvae reared under long day conditions at 25°C develop into summer morphs without pupal diapause, while larvae reared under short day conditions at 20°C develop into spring morphs after diapause development at 4°C for more than three months. To investigate the neuroendocrine mechanism regulating seasonal morph development, the activity of the summer-morph-producing hormone (SMPH) was tried to assayed by using male short day pupae of P. xuthus that accomplished diapause development at 4°C. The wing patterns of male butterflies shifted toward summer morphs when short day pupae were treated with the SMPH at an adequate stage. SMPH activity was detected in 2% NaCl extracts of the brain-subesophageal ganglion (Br-SG) complexes of P. xuthus long day pupae. Chilled male short day pupae responded to P.xuthus SMPH in a dose-dependent manner and lost the responsiveness within 2 days of transfer to room temperature (about 25°C). This is a report to show the existence of SMPH in butterfly species having pupal diapause.

Pyrokinin/PBAN-like peptides in the central nervous system of Drosophila melanogaster.

The pyrokinin/pheromone biosynthesis activating neuropeptide (PBAN) family of peptides found in insects is characterized by a 5-amino-acid C-terminal sequence, FXPRLamide. The pentapeptide is the active core required for diverse physiological functions, including stimulation of pheromone biosynthesis in female moths, stimulation of muscle contraction, induction of embryonic diapause in Bombyx mori, and stimulation of melanization in some larval moths. Recently, this family of peptides has been implicated in accelerating the formation of the puparium in a dipteran. Using bioassay and immunocytochemical techniques, we demonstrate the presence of pyrokinin/PBAN-like peptides in the central nervous system of Drosophila melanogaster. Pheromonotropic activity was shown in the moths Helicoverpa zeaand Helicoverpa armigera by using dissected larval nervous systems and adult heads and bodies of D. melanogaster. Polyclonal antisera against the C-terminal ending of PBAN revealed the location of cell bodies and axons in the central nervous systems of larval and adult flies. Immunoreactive material was detected in at least three groups of neurons in the subesophageal ganglion of 3rd instar larvae, pupae, and adults. The ring gland of both larvae and adults contained immunoreactivity. Adult brain-subesophageal ganglion complex possessed additional neurons. The fused ventral ganglia of both larvae and adults contained three pairs of neurons that sent their axons to a neurohemal organ connected to the abdominal nervous system. These results indicate that the D. melanogasternervous system contains pyrokinin/PBAN-like peptides and that these peptides could be released into the hemolymph.

Distribution of growth-blocking peptide in the insect central nervous tissue.

Parasitization of the armyworm Pseudaletia separata by the endoparasitic wasp Cotesia kariyai inhibits larval growth and delays pupation, conditions necessary for proper maturation of the parasite larvae. Parasitization is correlated with an elevated level of a 25-amino-acid hormone-like peptide, growth-blocking peptide (GBP, ENFSGGCVAGYMRTPDGRCKPTFYQ). Injection of synthetic GBP into nonparasitized larvae dose dependently mimics the effects of parasitization by delaying the larval development. Here we studied the relationship between parasitization and both the production and distribution of GBP in central nervous tissues. We found that parasitization is correlated with an elevated expression of GBP mRNA, and increased concentrations of both proGBP and GBP in the host insect brain and subesophageal ganglion. The increase in proGBP precedes that of the mature GBP by about 12 h. In situ hybridization analysis using sections of parasitized and nonparasitized larval brains showed strong expression of GBP mRNA in perineural cells and/or class I neuroglia in the rind of both larval brains. The expression in parasitized larval brain-subesophageal ganglion is approximately two- to threefold higher than that in nonparasitized larvae. The presence of GBP in insect neural tissue, and its role in inhibiting growth, suggest an involvement in the regulation of neurosecretory cells.

Regulation of Sex Pheromone Biosynthesis in Three Plusiinae Moths:Macdunnoughia confusa,Anadevidia peponis, andChrysodeixis eriosoma

Virgin females of M. confusa, A. peponis, and C. eriosoma secrete (Z)-7-dodecenyl acetate as a common main pheromone component. Their pheromone titers decreased after decapitation, and increased in the decapitated females after injection of a synthetic hormone, pheromone biosynthetic activating neuropeptide (PBAN) of Bombyx mori. In addition, an extract of brain-subesophageal ganglion complexes of each Plusiinae species activated pheromone biosynthesis in decapitated females of not only the corresponding species, but also that of Mamestra brassicae. These results indicate that pheromone biosynthesis of the three Plusiinae species is also controlled by a PBAN-like substance. However, the Plusiinae females exceptionally contained remarkable amounts of the pheromone even 1 day after decapitation. Since it has been reported that pheromones completely disappear at least 1 day after decapitation in females of many other lepdidoptran species including B. mori and M. brassicae, a different mechanism is likely regarding the regulation of the studied Plusiinae pheromone biosynthesis. Furthermore, an incorporation experiment with a labeled pheromone precursor, D9-(Z)-7-dodecenoic acid, showed that moderate biosynthesis still proceeded in the pheromone glands of M. confusa females 1 day after decapitation, providing an evidence why complete disappearance of the pheromone was not observed in the females which otherwise lacked a source of the pheromonotropic neuropeptide.

CDNA cloning and sequence determination of the pheromone biosynthesis activating neuropeptide of Mamestra brassicae: a new member of the PBAN family

Sex pheromone biosynthesis in a number of moth species is induced by a conserved 33-amino acid amidated neuropeptide PBAN (pheromone biosynthesis activating neuropeptide). Here, using immunoblotting and bioassay, we present evidence for the presence of a very similar peptide, called Mab-PBAN, in the brain–subesophageal ganglion complex of Mamestra brassicae females. A partial Mab-PBAN encoding cDNA was isolated using 3′RACE. The deduced amino acid sequence for Mab-PBAN is: LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL with a presumed amidated C-terminus. Mab-PBAN has high homology to the other members of the PBAN peptide family: 94% with Hez-PBAN, 87.9% with Lyd-PBAN and 78.8% with Bom-PBAN. The Mab-PBAN gene encodes, beside Mab-PBAN, at least three putative amidated peptides in the same reading frame, all of them having a common C-terminal pentapeptide motif F(T/S)P(R/K)L-NH 2.

Circadian Fluctuation of Catecholamines in the Cockroach Brain-Subesophageal Ganglion Complex detected by HPLC-ECD

Fluctuations of catecholamine contents in the cockroach brain-subesophageal ganglion (Br-SG) complex were examined by HPLC with electrochemical detector. The chromatographic system detected dopamine (DA), norepinephrine (NE), epinephrine (EP) and some putative metabolites as standard compounds. Da, NE and EP were detected in the Br-SG complex whereas those metabolites such as 2,5-dihydroxyphenylacetic acid (DOPAC) and 3-methoxy 4-hydroxy phenylglycol (MOPEG) were not detected from the tissue samples in a significant amount. The distribution of DA in the central nervous system was strongly biased toward cephalic ganglia, whereas EP was distributed more evenly over all ganglia. EP existed in both free and conjugated forms, the latter being predominant. Fluctuation patterns of these catecholamines were distinct; DA level kept constant throughout the day, at ca 200 ng/mg protein, NE showed a peak around AZT (artificial Zeitgeber time) 12, i.e., the light-off moment and the rhythm free-ran in constant darkness...

Free nucleotides related to the induction of diapause in the silkworm, Bombyx mori

Free nucleotides in pupal brains were examined in a bivoltine race (Daizo) of the silkworm, Bombyx mori, using high pressure liquid Chromatography (HPLC). Concentrations were nearly the same level as observed in rat brains. Major differences in monophosphates, diphosphates and triphosphates of purine and pyrimidine nucleotides, and an unidentified nucleotide derivative were observed between silkworms which were exposed to regimens of continuous light and warm conditions (27 °C) and those exposed to continuous darkness and cold conditions (15 °C) throughout maternal embryonic development. In particular, concentrations of ADP, ATP, GDP, GTP, IDP, ITP, UDP and UTP were more abundant in the pupal brains of insects exposed to continuous light and warm conditions. When brain-subesophageal ganglion complexes from non-diapause egg producers were cultured with mixtures of nucleotides, the resulting culture medium was highly effective in eliciting diapause in non-diapause egg producers. These results suggest that brain nucleotides have a role in diapause induction.