Additional Residues Research Articles

Separable additive quadratic residue codes over $Z_2Z_4$ and their applications

This paper examines separable additive quadratic residue codes (QRCs) over $\mathbb{Z}_{2}\mathbb{Z}_{4}$ and their applications. The idempotent generators of these codes are obtained. Further, the properties of separable additive QRCs over $\mathbb{Z}_{2}\mathbb{Z}_{4}$ are studied including their idempotent generators. As applications, these codes are used to construct self-dual, self-orthogonal, additive complementary pair (ACP) codes, additive complementary dual (ACD) codes, and additive $l$-intersection pairs of codes over $\mathbb{Z}_{2}\mathbb{Z}_{4}$.

Self-Sacrificed Additive in Preparing PbI2 Film Enables the Oriented Growth of Perovskite Crystals for Improved Solar Cell Performance.

Due to the limitation of the diffusion kinetics of organic amine salts on the PbI2 layer in the two-step method, prepared perovskite particles are small in size, have many defects, and are randomly oriented, and the cell efficiency and stability are difficult to guarantee due to PbI2 residues. Here, we added a volatile additive, N,N,N',N'-tetramethylethylenediamine (TMEDA), to the PbI2 precursor solution and formed preaggregated atomic clusters with PbI2 through TMEDA, which reduced the Gibbs free energy of nucleation to obtain a porous PbI2 layer, and finally obtained a perovskite film with large particles, few defects, ideal crystal plane orientation, and no additive residues. The results show that the photoelectric conversion efficiency of the optimized device is increased by 1.68% (from 21.68% to 23.36%), and the unpackaged optimized device still maintains the maximum efficiency of 77% after being placed in the air for 1200 h. This study provides an effective way to fabricate efficient and stable perovskite solar cells by promoting the nucleation-induced crystallization orientation by volatile additives.

A very versatile molecular machine.

In this issue (J Bacteriol. 206: e0014024, https://doi.org/10.1128/jb.00140-24), Ridone and Baker describe hybrids between two 5:2 heteroheptameric ion-powered motors. Chimeras were constructed between stator units of a bacterial flagellum and ExbBD of the Ton outer-membrane transport system. Only one of the 14 hybrids supported swimming in Escherichia coli. Three additional residue changes at sites distant from the hybrid region enhanced motility. This work suggests that flagellar stator units and ExbBD share an ancestor that diverged during evolution to perform different tasks.

An evaluation of source-blending impact on the calibration of SKA EoR experiments

ABSTRACT Twenty-one-centimetre signals from the Epoch of Reionization (EoR) are expected to be detected in the low-frequency radio window by the next-generation interferometers, particularly the Square Kilometre Array (SKA). However, precision data analysis pipelines are required to minimize the systematics within an infinitesimal error budget. Consequently, there is a growing need to characterize the sources of errors in EoR analysis. In this study, we identify one such error origin, namely source blending, which is introduced by the overlap of objects in the densely populated observing sky under SKA1-Low’s unprecedented sensitivity and resolution, and evaluate its two-fold impact in both the spatial and frequency domains using a novel hybrid evaluation (HEVAL) pipeline combining end-to-end simulation with an analytic method to mimic EoR analysis pipelines. Sky models corrupted by source blending induce small but severe frequency-dependent calibration errors when coupled with astronomical foregrounds, impeding EoR parameter inference with strong additive residuals in the two-dimensional power spectrum space. We report that additive residuals from poor calibration against sky models with blending ratios of 5 and 0.5 per cent significantly contaminate the EoR window. In contrast, the sky model with a 0.05 per cent blending ratio leaves little residual imprint within the EoR window, therefore identifying a blending tolerance at approximately 0.05 per cent. Given that the SKA observing sky is estimated to suffer from an extended level of blending, strategies involving de-blending, frequency-dependent error mitigation, or a combination of both, are required to effectively attenuate the calibration impact of source-blending defects.

Improving Hybrid Tin Halide Films of Lead-Free Perovskite Solar Cells with a Volatile Additive of Dipropyl Sulfide.

Lead-free perovskite solar cells with hybrid tin halides (Sn-PVKs) as harvesters have attracted attention with respect to eliminating the contamination of conventional hybrid lead halides. However, Sn-PVK films usually have inferior performance due to rapid crystallization and uncontrollable morphology. Moreover, Sn2+ ions suffer from irreversible oxidation that results in self-doping and device instability. Additive engineering is a key strategy for improving the quality of Sn-PVK films, but solid residues of additives could degrade the transport-recombination process. In this work, dipropyl sulfide (DPS) was introduced as a volatile additive into the precursor solution, and no residue exists in the Sn-PVK films after thermal annealing. The coordinating ability of DPS molecules stabilized Sn2+ ions to form the intermediate complex, which retards the crystallization and oxidation of Sn-PVK films. Consequently, the power conversion efficiencies of devices increase from 11.0% to 12.9% with less recombination and a lower leakage current, and the stability of the devices is improved simultaneously.

Novel Competitive ELISA Utilizing Trimeric Spike Protein of SARS-CoV-2, Could Identify More Than RBD-RBM Specific Neutralizing Antibodies in Hybrid Sera.

Since the initiation of the COVID-19 pandemic, there has been a need for the development of diagnostic methods to determine the factors implicated in mounting an immune response against the virus. The most promising indicator has been suggested to be neutralizing antibodies (nAbs), which mainly block the interaction between the Spike protein (S) of SARS-CoV-2 and the host entry receptor ACE2. In this study, we aimed to develop and optimize conditions of a competitive ELISA to measure serum neutralizing titer, using a recombinant trimeric Spike protein modified to have six additional proline residues (S(6P)-HexaPro) and h-ACE2. The results of our surrogate Virus Neutralizing Assay (sVNA) were compared against the commercial sVNT (cPass, Nanjing GenScript Biotech Co., Nanjing City, China), using serially diluted sera from vaccinees, and a high correlation of ID50-90 titer values was observed between the two assays. Interestingly, when we tested and compared the neutralizing activity of sera from eleven fully vaccinated individuals who subsequently contracted COVID-19 (hybrid sera), we recorded a moderate correlation between the two assays, while higher sera neutralizing titers were measured with sVNA. Our data indicated that the sVNA, as a more biologically relevant model assay that paired the trimeric S(6P) with ACE2, instead of the isolated RBD-ACE2 pairing cPass test, could identify nAbs other than the RBD-RBM specific ones.

Red/green cyanobacteriochromes acquire isomerization from phycocyanobilin to phycoviolobilin.

Cyanobacteriochromes (CBCRs) are unique cyanobacteria-specific photoreceptors that share a distant relation with phytochromes. Most CBCRs contain conserved cysteine residues known as canonical Cys, while some CBCRs have additional cysteine residues called second Cys within the DXCF motif, leading to their classification as DXCF CBCRs. They typically undergo a process where they incorporate phycocyanobilin (PCB) and subsequently isomerize it to phycoviolobilin (PVB). Conversely, CBCRs with conserved Trp residues and without the second Cys are called extended red/green (XRG) CBCRs. Typical XRG CBCRs bind PCB without undergoing PCB-to-PVB isomerization, displaying red/green reversible photoconversion, and there are also atypical CBCRs that exhibit diverse photoconversions. We discovered novel XRG CBCRs with Cys residue instead of the conserved Trp residue. These novel XRG CBCRs exhibited the ability to isomerize PCB to PVB, displaying green/teal reversible photoconversion. Through sequence- and structure-based comparisons coupled with mutagenesis experiments, we identified three amino acid residues, including the Cys residue, crucial for facilitating PCB-to-PVB isomerization. This research expands our understanding of the diversity of XRG CBCRs, highlighting the remarkable molecular plasticity of CBCRs.

Origin of ice in the Medusae Fossae Formation, equatorial Mars

We assess and test the recent radar-sounding findings of huge, kms-thick quantities of ice along the equatorial region of Mars covered by a thick protective cap (the Medusae Fossae Formation (MFF); Watters et al., 2024), using 1) atmospheric general circulation models (GCMs), 2) glacial ice accumulation and flow models, and 3) models for ice ablation-induced accumulation residues. Our results indicate that under Hesperian-era conditions, Mars at ∼40° spin-axis obliquity is predicted to accumulate snow/ice in excess of a km in less than a few million years in the MFF region, producing cold-based glaciers with basal melting over <7% of the deposit. We find that subsequent ablation of this ice deposit surface in the several billion year-long Amazonian during periods of episodic eolian stripping of MFF protective sublimation residues and dust/tephra deposits, provides a mechanism sufficient to form the thick capping layer. Similar, shorter-duration obliquity excursions during this period may have also contributed additional ice-sublation residue layers, consistent with the complex stratigraphy of the MFF. On the basis of the estimated non-ice component of the MFF ice deposit, we suggest that ablation alone could have formed the cap unit in a minimum of ∼350 million years, but was likely to have been episodic, operating in concert with periods of eolian surface lag removal over a much longer time period. The tripartite subdivision of MFF stratigraphy could indicate major periods of Amazonian obliquity excursions that deposited and removed thinner layers of ice and sublimation residue. The very high abundance of non-esker-like fluvial channels in part of the Lower Member of the MFF, combined with the paucity of ice-sheet basal melting in our analysis, suggests that ablation processes were sometimes dominated by top-down ice heating, melting and fluvial runoff. In summary, our three-part modeling approach supports the new findings, and offers new dimensions for the further analysis of the enigmatic MFF.

Miniprotein engineering for inhibition of PD-1/PD-L1 interaction.

Miniproteins constitute an excellent basis for the development of structurally demanding functional molecules. The engrailed homeodomain, a three-helix-containing miniprotein, was applied as a scaffold for constructing programmed cell death protein 1/programmed death-ligand 1 (PD-1/PD-L1) interaction inhibitors. PD-L1 binders were initially designed using the computer-aided approach and subsequently optimized iteratively. The conformational stability was assessed for each obtained miniprotein using circular dichroism spectroscopy, indicating that numerous mutations could be introduced. The formation of a sizable hydrophobic surface at the inhibitor that fits the molecular target imposed the necessity for the incorporation of additional charged amino acid residues to retain its appropriate solubility. Finally, the miniprotein effectively binding to PD-L1 (KD = 51.4 nM) that inhibits PD-1/PD-L1 interaction in cell-based studies with EC50 = 3.9 μM, was discovered.

Conjugation with the Carrier Helped to Reveal acidification-Induced Structural Shift in the Peptide from Phospholipase Domain of Parvovirus B19.

Spectroscopic studies on domains and peptides of large proteins are complicated because of the tendency of short peptides to form oligomers in aquatic buffers, but conjugation of a peptide with a carrier protein may be helpful. In this study we approved that a fragment of SK30 peptide from phospholipase A2 domain of VP1 Parvovirus B19 capsid protein (residues: 144-159; 164; 171-183; sequence: SAVDSAARIHDFRYSQLAKLGINPYTHWTVADEELLKNIK) turns from random coil to alpha helix in the acidic medium only in case if it had been conjugated with BSA (through additional N-terminal Cys residue, turning it into CSK31 peptide, and SMCC linker) according to CD-spectroscopy results. In contrast, unconjugated SK30 peptide does not undergo such shift because it forms stable oligomers connected by intermolecular antiparallel beta sheet, according to IR-spectroscopy, CD-spectroscopy, blue native gel electrophoresis and centrifugal ultrafiltration, as, probably, the whole isolated phospholipase domain of VP1 protein does. However, being a part of the long VP1 capsid protein, phospholipase domain may change its fold during the acidification of the medium in the endolysosome by the way of the formation of contacts between protonated His153 and Asp175, promoting the shift from random coil to alpha helix in its N-terminal part. This study opens up a perspective of vaccine development, since rabbit polyclonal antibodies against the conjugate of CSK31 peptide with BSA, in which the structure of the second alpha helix from the phospholipase A2 domain should be reproduced, can bind epitopes of the complete recombinant unique part of VP1 Parvovirus B19 capsid (residues: 1-227).

Hierarchical determinants in cytotoxic necrotizing factor (CNF) toxins driving Rho G-protein deamidation versus transglutamination.

The cytotoxic necrotizing factor (CNF) family of AB-type bacterial protein toxins catalyze two types of modification on their Rho GTPase substrates: deamidation and transglutamination. It has been established that E. coli CNF1 and its close homolog proteins catalyze primarily deamidation and Bordetella dermonecrotic toxin (DNT) catalyzes primarily transglutamination. The rapidly expanding microbial genome sequencing data have revealed that there are at least 13 full-length variants of CNF1 homologs. CNFx from E. coli strain GN02091 is the most distant from all other members of the CNF family with 50%-55% sequence identity at the protein level and 0.45-0.52 nucleotide substitutions per site at the DNA level. CNFx modifies RhoA, Rac1, and Cdc42, and like CNF1, activates downstream SRE-dependent mitogenic signaling pathways in human HEK293T cells, but at a 1,000-fold higher EC50 value. Unlike other previously characterized CNF toxins, CNFx modifies Rho proteins primarily through transglutamination, as evidenced by gel-shift assay and confirmed by MALDI mass spectral analysis, when coexpressed with Rho-protein substrates in E. coli BL21 cells or through direct treatment of HEK293T cells. A comparison of CNF1 and CNFx sequences identified two critical active-site residues corresponding to positions 832 and 862 in CNF1. Reciprocal site-specific mutations at these residues in each toxin revealed hierarchical rules that define the preference for deamidase versus a transglutaminase activity in CNFs. An additional unique Cys residue at the C-terminus of CNFx was also discovered to be critical for retarding cargo delivery.IMPORTANCECytotoxic necrotizing factor (CNF) toxins not only play important virulence roles in pathogenic E. coli and other bacterial pathogens, but CNF-like genes have also been found in an expanding number of genomes from clinical isolates. Harnessing the power of evolutionary relationships among the CNF toxins enabled the deciphering of the hierarchical active-site determinants that define whether they modify their Rho GTPase substrates through deamidation or transglutamination. With our finding that a distant CNF variant (CNFx) unlike other known CNFs predominantly transglutaminates its Rho GTPase substrates, the paradigm of "CNFs deamidate and DNTs transglutaminate" could finally be attributed to two critical amino acid residues within the active site other than the previously identified catalytic Cys-His dyad residues. The significance of our approach and research findings is that they can be applied to deciphering enzyme reaction determinants and substrate specificities for other bacterial proteins in the development of precision therapeutic strategies.

Phosphorylation by Protein Kinase C Weakens DNA-Binding Affinity and Folding Stability of the HMGB1 Protein.

The HMGB1 protein typically serves as a DNA chaperone that assists DNA-repair enzymes and transcription factors but can translocate from the nucleus to the cytoplasm or even to extracellular space upon some cellular stimuli. One of the factors that triggers the translocation of HMGB1 is its phosphorylation near a nuclear localization sequence by protein kinase C (PKC), although the exact modification sites on HMGB1 remain ambiguous. In this study, using spectroscopic methods, we investigated the HMGB1 phosphorylation and its impact on the molecular properties of the HMGB1 protein. Our nuclear magnetic resonance (NMR) data on the full-length HMGB1 protein showed that PKC specifically phosphorylates the A-box domain, one of the DNA binding domains of HMGB1. Phosphorylation of S46 and S53 was particularly efficient. Over a longer reaction time, PKC phosphorylated some additional residues within the HMGB1 A-box domain. Our fluorescence-based binding assays showed that the phosphorylation significantly reduces the binding affinity of HMGB1 for DNA. Based on the crystal structures of HMGB1-DNA complexes, this effect can be ascribed to electrostatic repulsion between the negatively charged phosphate groups at the S46 side chain and DNA backbone. Our data also showed that the phosphorylation destabilizes the folding of the A-box domain. Thus, phosphorylation by PKC weakens the DNA-binding affinity and folding stability of HMGB1.

Protein engineering enables a soakable crystal form of human CDK7 primed for high-throughput crystallography and structure-based drug design

Cyclin dependent kinase 7 (CDK7) is an important therapeutic kinase best known for its dual role in cell cycle regulation and gene transcription. Here, we describe the application of protein engineering to generate constructs leading to high resolution crystal structures of human CDK7 in both active and inactive conformations. The active state of the kinase was crystallized by incorporation of an additional surface residue mutation (W132R) onto the double phosphomimetic mutant background (S164D and T170E) that yielded the inactive kinase structure. A novel back-soaking approach was developed to determine crystal structures of several clinical and pre-clinical inhibitors of this kinase, demonstrating the potential utility of the crystal system for structure-based drug design (SBDD). The crystal structures help to rationalize the mode of inhibition and the ligand selectivity profiles versus key anti-targets. The protein engineering approach described here illustrates a generally applicable strategy for structural enablement of challenging molecular targets.

Distinctive contribution of two additional residues in protein aggregation of Aβ42 and Aβ40 isoforms

Distinctive contribution of two additional residues in protein aggregation of Aβ42 and Aβ40 isoforms

Genome organization of satellite DNA beta molecule associated with Mungbean yellow mosaic India virus Gujarat, India

Recent advancements in genomics have unveiled fascinating insights into the intricate world of plant pathogens. The discovery of an intriguing association between the DNA beta and MYMIV-[IN:Ana: CpMBKA25:04], a strain containing 1367 base pairs of nucleotides, has sparked a wave of scientific curiosity. Through sequence identity matrix analysis, it was revealed that this strain shares a striking 96% similarity with the Potato apical leaf curl virus, closely followed by the Tomato leaf curl beta satellite virus [Accession No. AY230138] at 95.3%. In contrast, its relationship with the beta satellite Bhendi yellow vein beta satellite [Accession No. AJ308425] stood at a comparative 45.7% when compared against seventeen other DNA beta isolates infecting various crops. Noteworthy features of the beta satellite sequences include a distinctive putative stem-loop structure TAATATT/AC in the common region and a recurring GCTACGC repeat sequence. An A-rich region spanning from nucleotides 910 to 1120 further adds to the genetic complexity of this novel strain. Intriguingly, an analysis of the amino acid sequence unveiled additional residues V, C, and N at the carboxyl end of the βC1 protein, setting it apart from its counterparts. The identity matrix analysis established a 95.9% similarity between βC1 and the beta satellite associated with Tomato leaf curl Karnataka virus and Potato apical leaf curl virus, phylogenetic analysis placed the beta satellite linked with MYMIV-[IN:Ana: CpMBKA25:04] in a distinct category within the Papaya leaf curl virus family, shedding light on its unique evolutionary lineage and biological significance in the realm of plant virology.

Leveraging shape screening and molecular dynamics simulations to optimize PARP1-Specific chemo/radio-potentiators for antitumor drug design

PARP1 plays a pivotal role in DNA repair within the base excision pathway, making it a promising therapeutic target for cancers involving BRCA mutations. Current study is focused on the discovery of PARP inhibitors with enhanced selectivity for PARP1. Concurrent inhibition of PARP1 with PARP2 and PARP3 affects cellular functions, potentially causing DNA damage accumulation and disrupting immune responses. In step 1, a virtual library of 593 million compounds has been screened using a shape-based screening approach to narrow down the promising scaffolds. In step 2, hierarchical docking approach embedded in Schrödinger suite was employed to select compounds with good dock score, drug-likeness and MMGBSA score. Analysis supplemented with decomposition energy, molecular dynamics (MD) simulations and hydrogen bond frequency analysis, pinpointed that active site residues; H862, G863, R878, M890, Y896 and F897 are crucial for specific binding of ZINC001258189808 and ZINC000092332196 with PARP1 as compared to PARP2 and PARP3. The binding of ZINC000656130962, ZINC000762230673, ZINC001332491123, and ZINC000579446675 also revealed interaction involving two additional active site residues of PARP1, namely N767 and E988. Weaker or no interaction was observed for these residues with PARP2 and PARP3. This approach advances our understanding of PARP-1 specific inhibitors and their mechanisms of action, facilitating the development of targeted therapeutics.

Tight-packing of large pilin subunits provides distinct structural and mechanical properties for the Myxococcus xanthus type IVa pilus

Type IVa pili (T4aP) are ubiquitous cell surface filaments important for surface motility, adhesion to surfaces, DNA uptake, biofilm formation, and virulence. T4aP are built from thousands of copies of the major pilin subunit and tipped by a complex composed of minor pilins and in some systems also the PilY1 adhesin. While major pilins of structurally characterized T4aP have lengths of <165 residues, the major pilin PilA of Myxococcus xanthus is unusually large with 208 residues. All major pilins have a conserved N-terminal domain and a variable C-terminal domain, and the additional residues of PilA are due to a larger C-terminal domain. We solved the structure of the M. xanthus T4aP (T4aPMx) at a resolution of 3.0 Å using cryo-EM. The T4aPMx follows the structural blueprint of other T4aP with the pilus core comprised of the interacting N-terminal α1-helices, while the globular domains decorate the T4aP surface. The atomic model of PilA built into this map shows that the large C-terminal domain has more extensive intersubunit contacts than major pilins in other T4aP. As expected from these greater contacts, the bending and axial stiffness of the T4aPMx is significantly higher than that of other T4aP and supports T4aP-dependent motility on surfaces of different stiffnesses. Notably, T4aPMx variants with interrupted intersubunit interfaces had decreased bending stiffness, pilus length, and strongly reduced motility. These observations support an evolutionary scenario whereby the large major pilin enables the formation of a rigid T4aP that expands the environmental conditions in which the T4aP system functions.

A subgroup of light-driven sodium pumps with an additional Schiff base counterion

Light-driven sodium pumps (NaRs) are unique ion-transporting microbial rhodopsins. The major group of NaRs is characterized by an NDQ motif and has two aspartic acid residues in the central region essential for sodium transport. Here we identify a subgroup of the NDQ rhodopsins bearing an additional glutamic acid residue in the close vicinity to the retinal Schiff base. We thoroughly characterize a member of this subgroup, namely the protein ErNaR from Erythrobacter sp. HL-111 and show that the additional glutamic acid results in almost complete loss of pH sensitivity for sodium-pumping activity, which is in contrast to previously studied NaRs. ErNaR is capable of transporting sodium efficiently even at acidic pH levels. X-ray crystallography and single particle cryo-electron microscopy reveal that the additional glutamic acid residue mediates the connection between the other two Schiff base counterions and strongly interacts with the aspartic acid of the characteristic NDQ motif. Hence, it reduces its pKa. Our findings shed light on a subgroup of NaRs and might serve as a basis for their rational optimization for optogenetics.

Abstract 2720: Engineering sweeping antibodies for the clearance of tumor-derived, pro-tumorigenic cytokines

Abstract Soluble, tumor-derived, pro-tumorigenic (STP) cytokines have been shown to contribute to cancer cell proliferation and drug resistance. But therapeutic targeting of STP cytokines by monoclonal antibodies is limited by high concentrations and persistent production of antigen. We hypothesize that the ability of sweeping antibodies (swAbs) to actively clear soluble antigens will overcome these limitations. SwAbs differ from conventional antibodies via (1) pH-dependent binding of antigen, and (2) increased binding to the neonatal Fc receptor (FcRn). SwAbs facilitate clearance of soluble antigens by releasing antigen in the low pH environment of FcRn-expressing cells. SwAbs are then recycled via FcRn for repeated clearance of antigen.We are developing swAbs against four STP cytokines contributing to cancer cell proliferation, survival, migration or intra-tumoral angiogenesis: hepatocyte growth factor (HGF), vascular endothelial growth factor (VEGF), transforming growth factor-β (TGF-β) and interleukin 16 (IL-16). We selected four existing neutralizing antibodies against these cytokines with available crystal structures and generated a second antibody targeting interleukin 16 with high affinity (clone 3B6; KD = 13 nM) de novo using phage display. We are using bio-layer interferometry and custom recycling/clearance assays for antibody characterization and pre-clinical validation. To introduce pH dependency into the four antibodies with crystal structures, we performed targeted histidine mutagenesis of residues at the interface with the respective target antigens. For the de novo-generated interleukin-16 antibody, we performed an unbiased histidine scanning approach by mutating residues across all six complementarity-determining regions (CDRs), which resulted in slight increases in pH sensitivity. We then performed a second round of mutagenesis of the most pH-sensitive 3B6 variants by replacing additional residues considered developability liabilities with histidine residues. We found that this approach significantly increased expression and affinity at pH 7 of the resulting 3B6 variants but only modestly increased pH sensitivity. In contrast, replacing a single residue in the heavy CDR1 in clone 14.1, a pre-clinical anti-IL-16 antibody, resulted in substantially increased pH sensitivity (KD(pH=7) = 2 nM; KD(pH&amp;lt;6) = n.b.). We are currently performing pH-sensitivity screenings for the three additional STP-specific antibodies. Our findings indicate that the ability to introduce pH sensitivity is largely dependent on the parental antibody and that some antibodies may not be amenable to this process. In addition, we show that histidine mutagenesis can be an effective approach to enhance expressibility and binding, while also increasing pH sensitivity. This project will answer the question whether anti-STP cytokine swAbs are an effective approach to treat patients with cancer. Citation Format: Jillian M. Baker, Nevil J. Singh, Tim Luetkens. Engineering sweeping antibodies for the clearance of tumor-derived, pro-tumorigenic cytokines [abstract]. In: Proceedings of the American Association for Cancer Research Annual Meeting 2024; Part 1 (Regular Abstracts); 2024 Apr 5-10; San Diego, CA. Philadelphia (PA): AACR; Cancer Res 2024;84(6_Suppl):Abstract nr 2720.

Application of Gas Chromatography in Food Safety Testing

Food safety is an important issue of people s livelihood, which is a matter of great concern to every country. With the increase of industrial pollution and the use of chemical pesticides in crop production, the safety of food is getting lower and lower. Gas chromatography can be used to detect the residues of additives and harmful substances in food, so as to improve the safety of food. In this paper, gas chroma- tography technology was analyzed, and its application in food safety testing was discussed.