Abstract
Due to the sustainable organic matter bioconversion process used as substrate for its development, the Hermetia illucens (Linnaeus) larvae biomass is considered a source of compounds with high aggregate value and quite a promising market. The materials that can be extracted from H. illucens larvae have opened the door to a diverse new field of ingredients, mainly for the feed and food industry, but also with potential applicability in cosmetics. In this review we succinctly describe the larval development and rearing cycle, the main compounds identified from different types of extractions, their bioactivities and focus on possible applications in cosmetic products. A search was made in the databases PubMed, ScienceDirect and Web of Science with the terms ‘Hermetia illucens’, ‘bioactives’, ‘biochemical composition’ and ‘cosmetics ingredients’, which included 71 articles published since 1994.
Highlights
In the last decade a growing demand for natural and renewable sourced ingredients has been noticed, driving different types of industries, such as animal feed, human foods, pharmaceutical and cosmetics to offer the consumer increasingly innovative products.The sustainable exploitation of natural resources can be further improved if integrated solutions are employed to tackle the problems of overproduction, disposal of solid organic waste and growing demand for natural raw materials
Natural bioactives have been found in nature from diverse sources like plants, animals and different types of microorganisms [2]
The larval stage has waste management agent [7] and its biomass can provide compounds with high aggregated-value. The aim of this brief review is to present the biomass composition of H.illucens larvae, describe the properties of the compounds obtained from their extracts, as well as identify possible applications in the development of innovative cosmetic formulations
Summary
In the last decade a growing demand for natural and renewable sourced ingredients has been noticed, driving different types of industries, such as animal feed, human foods, pharmaceutical and cosmetics to offer the consumer increasingly innovative products. There is a sound rationale for this, since insects are highly efficient waste bio converters, induce a low environmental impact, since they emit less climate-damaging greenhouse gases and consume less water, and the risk of zoonosis is reduced [3,4] They can be fed with organic waste from various sources and can be reared on small surfaces, making large-scale industrial breeding possible [5]. The larval stage (with five phases) has waste management agent [7] and its biomass can provide compounds with high aggregated-value The aim of this brief review is to present the biomass composition of H.illucens larvae, describe the properties of the compounds obtained from their extracts, as well as identify possible applications in the development of innovative cosmetic formulations. HI.niltlhueceHns. lilalruvceanesalriefeacbyleclteo, tfheeedtroannsaitnioinmfmroemnstehvealrairevtayl otof othrgeaandiculmt sattaegrieaol.cDcuirffserfoenllot wsuinbgstraates hapvaessaaglreetahdryoubgehena naypmpplihedphinaseth, eeairchrewairtihngd,ifrfearnegnitnmgofrrpohmolomgaiensuarned, clihfeichkaebnitsf.eTedhi,svinesgeecttasbpleecwiesaste, rehsatasuarashnot rwt adsetvee,laospmweenlltalsifewcinycelreylaasntdinbgr4e5wderayysagwrioth-infoduurstsrtaiaglebs-y-epgrgo(d4udctasys[1),5l]a. rDvaiffl e(1r8endtasytsu)d, ies repproerptutphaalt (t1h4edsuaybss)traantde oadffuerlted(9hdaasyasn) [i6m,9p,1a0c]t. oTnhetheeggdsevareelospmmaleln(taraonudnbdio1cmhemm)iacnadl cpormespeonstiatioconloorf the larravnagee(Tbaebtwlee1e)n, bwuhticteonacnedntcrraetaimon, saos fslhipowidns ainrofuignudre302%[1a]n. dThperolatervinalasrotaugned(w40it%h ofifvderpyhwaseeisg)hht a(Ds W) are normally obtained [9]
Talk to us
Join us for a 30 min session where you can share your feedback and ask us any queries you have