Abstract

This paper is about the position of workforce and employment considerations within the sustainable tourism narrative. The paper aims to address the relative neglect of this area within the discourse of sustainable tourism and highlights references to the workforce within the United Nations’ 2030 Agenda for Sustainable Development. The discussion follows the emerging field of sustainable human resource management and the contribution that this can make to meeting both the UN Sustainable Development Goals and to enhancing the recognition of workforce and employment issues within the related debate in tourism. The body of the paper highlights examples of key dimensions of work and employment across varied tourism contexts, where sustainability is of increasing consequence and significance. The paper concludes by drawing together the implications of these “mini-cases” and locating them within key principles of the 2030 Agenda for Sustainable Development.

Highlights

  • The challenges that tourism faces in terms of employment, workforce or Human Resource Management (HRM) have been very well documented over an extended period

  • If the examples given in the previous paragraph represent unsustainable workforce characteristics or widespread and entrenched practices in tourism, the corollary is represented by practices that do focus on ”decent work”, do provide opportunity on an equal basis for all members of the community, are progressive and developmental and compete successfully for skills with other sectors of the local, national and international economy

  • The findings further suggest that organizations and individuals have respective obligations in the career management of employees

Read more

Summary

Introduction

In 2015, the United Nations Sustainable Development Summit endorsed the 2030 Agenda for Sustainable DeIvInne2l20o01p155m,,thtehneetU,UnwnitiheteidcdhNNhaatiitgoiohnnslsigSSuhuststsatai1ni7naabSbluelesDtDaeeivnveealolboplpemmDeennetvtSeSulumompmmmitietenenntddGoororsseaedldst(htSheeD22G003s30)0AdAgegeseningddnaaefdfoortro end poverStSyuu,ssfitataginihnatabbilneleeDDqeuevvaeeloilotpypmmaenenndt,t,iwnwhjuhicischthihcheigigahhnlilgdighhttastsc1k177leSSucuslstiatmainianatabeblelcehDDaeenvvgeeleolopbpmyme2en0nt3tG0Go.oaWalslsh((SiSlDeDGoGsns))ldydeetshsigiegnneedidgthototh goal (deceneentndwdpoporokvveaerrntytdy,,fefigimghhpttlionineyeqmquueaanliltiytygaranondwditnihnju)jusstpitciececeiafianncddatlatlaycckrkleelefceclrilemimnacatetesccthhaaenngwgeeobrbyky2p20l0a330c0.e.WaWnhhdilieltehooennleylyntvhthiereoeeingigmhhtehthnt of work, itggiosoaalalr(g(ddueecacebenlntet twhwoaortrkka asaningddniefiemmcpaplnolotyymnmueenmnttbgegrrrooowwfthtthh))esspgpeoecacifilfiscicaiamllylypirnreegffeerreiennncceoesns eththweeawywoorrrkkpaplnalacocetehaeanrnddonththtehee workforceeeannnvvidriroownnmomreeknnpttlooaffcwewoiornrkk,t,oitiutirsisisaamrrggu.uaTabbhleluetsht,haawttaoarsskigig,nnaifinficidcaanintntndnueumemdbbe“errdooeffctehthneetggwooaoalslrskimi”mpapisningtgheeeininInootnenerenwwaatayiyoonorral Labour Oragananonothtihseaerrtoionnntht(hIeLewOwo)orrkwkffooorurccledeaansntdydwlweoiortrk,kpipslalaccteetihninetothoueurarisirsmtmo..fTTthhuuess,s,wuwosotrarkki,n,aaannbddiliintndydeedeededb““addteeec.ceeNnnttowwoohrrkek”r”eaasissthtthheeis. We will explore the positioning of workforce considerations within the discussion about sustainable tourism, or the absence thereof, and seek to demonstrate the relevance of the sustainability narrative to a selection of workforce-related themes in the context of tourism and the United Nations Sustainable Development Agenda. By this means, we hope to illustrate the value of meeting specific goals and the wider principles enshrined within the agenda, to address the considerable challenges faced by tourism with respect to its workforce. These, in turn, inhibit generalization between, for example, less developed and developed economies

Sustainable Tourism and Employment
Applying Sustainability to the Workforce Domain in Tourism
Generational Perspectives on Employment and Sustainability in Tourism
Career Competencies of Employees in Tourism
Sustainable Human Resource Management in Tourism: A Human Rights Issue
Findings
Conclusions
Full Text
Paper version not known

Talk to us

Join us for a 30 min session where you can share your feedback and ask us any queries you have

Schedule a call

Disclaimer: All third-party content on this website/platform is and will remain the property of their respective owners and is provided on "as is" basis without any warranties, express or implied. Use of third-party content does not indicate any affiliation, sponsorship with or endorsement by them. Any references to third-party content is to identify the corresponding services and shall be considered fair use under The CopyrightLaw.