Abstract
The development of universal influenza vaccine - a vaccine directed to all subtypes of human influenza A viruses - is the really actual problem task. This paper presents the comparative characteristic of the specific activity of various recombinant proteins consisting of antigenic determinants of influenza A virus - the ectodomain of the M2 protein (M2e) and a fragment of the second subunit of the hemagglutinin (the amino acid sequence 76 - 130). Flagellin - Salmonella typhimurium protein was used as carrier protein and as adjuvant. We use two forms of flagellin: full size and with deleted hypervariable region. The proteins showed high immunogenicity, and the ability to prevent lethal infection of influenza virus in mice. Full-length flagellin with HA2 (76 - 130) and M2e on the C-terminus (protein Flg-HA2-4M2e) demonstrated the most protective properties. It provides 100% survival immunized mice that were challenge with a high dose of influenza A (H3N2) - 10 LD50. Proteins containing only full sized flagellin with M2e or flagellin truncated form with M2e at the C-terminus and HA2 within the hypervariable region, protected 75% of animals from lethal infection. Protein Flg-HA2-4M2e is promising for further study as a vaccine.
Highlights
Называемой, «обратной вакцинологии» [1], в основе которых лежит анализ in silico всех белков инфекционного агента и выбор в качестве иммуногенов тех, что отвечают целям разрабатываемой вакцины
В настоящей статье дана сравнительная характеристика специфической активности нескольких вариантов рекомбинантного вакцинного белка, включающего антигенные детерминанты вируса гриппа
Гуморальный ответ на пептид 76 – 130 НА2 был более выражен при локализации его в гипервариабельной части молекулы флагеллина, чем на С-конце
Summary
Называемой, «обратной вакцинологии» [1], в основе которых лежит анализ in silico всех белков инфекционного агента и выбор в качестве иммуногенов тех, что отвечают целям разрабатываемой вакцины. В качестве консервативных пептидов вируса гриппа, предназначенных для включения в состав рекомбинантных вакцинных белов, были выбраны: М2h – консенсусная последовательность протеина М2е штаммов вируса гриппа А человека: SLLTEVETPIRNEWGCRCNDSSD; М2k – M2e вируса птичьего высоко патогенного гриппа A/Kurgan/05/2005 H5N1: SLLTEVETPTRNEWECRCSDSSD; НА2 – консенсусная аминокислотная последовательность (ак 76 – 130) второй субъединицы НА вирусов гриппа А субтипов Н3 и Н7, относящихся ко второй филогенетической группе: RIQDLEKYVED TKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQL RENA.
Talk to us
Join us for a 30 min session where you can share your feedback and ask us any queries you have