Abstract

We previously characterized a purine-specific Na(+)-nucleoside cotransport system in bile canalicular membrane. The function of this transport system may be related to conserving nucleosides and preventing cholestasis. We report here the isolation of a cDNA encoding a Na(+)-dependent nucleoside transporter from rat liver using an expression cloning strategy. The substrate specificities and kinetic characteristics of the cloned cotransporter are consistent with the properties of the Na(+)-dependent, purine-selective nucleoside transporter in bile canalicular membranes. The nucleotide sequence predicts a protein of 659 amino acids (72 kDa) with 14 putative membrane-spanning domains. Northern blot analysis showed that the transcripts are present in liver and several other tissues. Data base searches indicate significant sequence similarity to the pyrimidine-selective nucleoside transporter (cNT1) of rat jejunum. Although these two subtypes of Na(+)-nucleoside cotransporter have different substrate specificities and tissue localizations, they are members of a single gene family.

Highlights

  • We previously characterized a purine-specific Na+ nucleoside cotransport system in bile canalicular membrane

  • We report here the isolation of a cDNA encoding a Na+ -dependent nucleoside transporter from rat liver using an expression cloning strategy

  • The substrate specificities and kinetic characteristics of the cloned cotransporter are consistent with the properties of the Na+-dependent, purine-selective nucleoside transporter in bile canalicular membranes

Read more

Summary

EXPERIMENTAL PROCEDURES

RNA Isolation and Poly(A) + RNA Selection and Fractionation-Total RNAwas extracted from male Wistar rat liver and other tissues using the acid guanidine thiocyanate/phenol/chloroform extraction method [18]. X. laevis Oocytes and Na +-dependent Nucleoside Transport Measurements-Oocytes were dissected from ovarian fragments of X. laevis, defolliculated manually, and incubated in modified Barth's solution. Oocytes were washed with a Na" -free buffer (100 IllM choline chloride, 2 IllM KCl, 1 mM CaCI2, 1 IllM MgC12' and 10 IllM HEPES-Tris (pH 7.5» and placed in a Na" (100 mMNaCI) or sodium-free (100 IllM choline chloride) buffer containing [2,8-3Hladenosine (32.9 Ci/mmol, DuPont NEN). Library Construction and Clone Isolation-A directional cDNA library was constructed in the plasmid vector pSPORTl (SuperScript, Life Technologies, Inc.) using the size-fractionated pclyt.A)" RNA that gave rise to peak Na t-dependent adenosine uptake.

RESULTS AND DISCUSSION
H B M Lu L
71 YQRHAGLFKKILLGLLCLAYAAYLLAACILNFRRALALFVITCLVIFILACHFLKKFFAKKSIRCLKPLK
Full Text
Paper version not known

Talk to us

Join us for a 30 min session where you can share your feedback and ask us any queries you have

Schedule a call

Disclaimer: All third-party content on this website/platform is and will remain the property of their respective owners and is provided on "as is" basis without any warranties, express or implied. Use of third-party content does not indicate any affiliation, sponsorship with or endorsement by them. Any references to third-party content is to identify the corresponding services and shall be considered fair use under The CopyrightLaw.