Abstract
The development of hair follicle in cashmere goats shows significant periodic change, as with mice and humans. However, for cashmere goat with double-coat, the periodic change may be due to other regulatory molecules and signal pathways. To understand the mechanism of periodic development of hair follicle, we performed a weighted gene coexpression network analysis (WGCNA) to mine key genes and establish an interaction network by utilizing the NCBI public dataset. Ten coexpression modules, including 7689 protein-coding genes, were constructed by WGCNA, six of which are considered to be significantly related to the development of the hair follicle cycle. A functional enrichment analysis for each model showed that they are closely related to ECM- receptor interaction, focal adhesion, PI3K-Akt signaling pathway, estrogen signaling pathway, and so on. Combined with the analysis of differential expressed genes, 12 hub genes from coexpression modules were selected as candidate markers, i.e., COL1A1, C1QTNF6, COL1A2, AQP3, KRTAP3-1, KRTAP11-1, FA2H, NDUFS5, DERL2, MRPL14, ANTKMT and XAB2, which might be applied to improve cashmere production.
Highlights
Hair is one of characteristics of mammals
Whheennββwwaasssseettaatt99,tthhee ssccaallee--ffrreeee network nnTwfieehtttaetwwisnnoo,rgrrtehkkilenafwitddtiatevyisnxnerglareymeilnaahitdcciivehghxeehyldryb,erah0wicd.i8hgh-5cheiudc,(thwF0tii.nhg8mgi5uceh(rmtFemietg2theuhAetro)etdsha2cewnAadsla)ecsaat-nhfulerdese-efetcrdheoneetnoecnnotceewnltcuwnotseiortvcekrtirkitvydgdietibiysnsettebrrtsiiwebbtiwunuetteteoiinoeonnmnggo(eF(ednFinugeieuslgseruisien,nrea2ttnBhh2d)eeB. )n.etTwhoernk, stihmeildarynmaomduiclehsywberride -mcuetrtgiendg bmyestehtotidngwthaes uMsEeDditsosTchlruesstecrutgtienngeslininettoom0.o25du(il.ee.s,tahned similar mmooddeulslwesitwh 7e5r%e mofeeriggeendgbenyessestimtinilgartithyewMerEeDmiesrsgTehdr)e(sFicguutrtein3Ag)l.iMneEptionk 0w.2er5e(mi.eer.,gtehde models iwn iMthEm7a5ge%nta,oinf aedigdeitniogne,nMesEbsluiemanildarMitEyrewd weereremmergeedd)in(FMigEtuurrqeuois3e.AF)i.naMllyE,ptiennk mwoedruelems erged in MEmagenta, in addition, MEblue and MEred were merged in MEturquoise
Through the adjacency heatmap of the relationship for each model (Figure 3D), we found that the coexpression relationship of genes from the same module was strong and the ten modules were relatively independent from each other
Summary
Hair is one of characteristics of mammals. The upper permanent region is comprised of the infundibulum and isthmus, which are relatively stable, whiles the lower follicle is comprised of the hair bulb and suprabulbar region, which undergo periodic regeneration [1]. Follicular papilla in the hair bulb dictates the induction and maintenance of the follicular epithelial differentiation, and determines anagen duration, hair shaft diameter and length [1,2]. Hair follicles do not enter the self-renewal cycle until they are fully developed after birth, and experience growth (anagen), regression (catagen), and a rest period (telogen), followed hair shedding [3]. The cyclic change is similar in mammals, but the molecule regulatory mechanism may be different due to the different length of cycle and the species-specific morphologies of HF [4]
Sign-in/Register to view highlights & summary Talk to us
Join us for a 30 min session where you can share your feedback and ask us any queries you have
Schedule a callDisclaimer: All third-party content on this website/platform is and will remain the property of their respective owners and is provided on "as is" basis without any warranties, express or implied. Use of third-party content does not indicate any affiliation, sponsorship with or endorsement by them. Any references to third-party content is to identify the corresponding services and shall be considered fair use under The CopyrightLaw.
