Abstract

The integrins are a large family of heterodimeric cell-surface glycoproteins that play key roles in the adherence of cells to other cells and to extracellular matrix proteins. We have previously reported the identification of a novel integrin beta subunit partial cDNA from leukocytes. We have now determined the complete sequence of this subunit, designated as beta 7, from overlapping clones obtained from a PEER T leukemia cell library and a peripheral T cell library. The beta 7 cDNA contains a single large open reading frame predicted to encode a 798-amino acid protein precursor (signal peptide plus mature protein). The beta 7 protein, like the other beta subunit proteins, is predicted to contain a large extracellular portion, a transmembrane domain, and a cytoplasmic tail. The deduced beta 7 amino acid sequence is 32-46% identical to the six previously sequenced human integrin beta subunits. beta 7 is most similar to the leukocyte integrin common beta subunit (beta 2, CD18). Analysis of variant beta 7 cDNA clones and reverse transcription-polymerase chain reaction products suggest that alternatively spliced beta 7 mRNAs can be generated by the removal of exons that encode most of the cysteine-rich region of the extracellular portion of beta 7. By Northern blot analysis, beta 7 mRNA was detected in T and B cell lines and in macrophage-like cell lines, but not in any of the nonleukocyte cell lines tested. Peripheral T cells and some lymphoma lines express little beta 7 mRNA before stimulation; but after stimulation with phorbol ester, beta 7 mRNA levels increased markedly. Integrin beta 7 is expected to play a role in adhesive interactions of leukocytes.

Highlights

  • The integrins are a large family of heterodimeric tegrins that arecrucial participants in the inflammatory and cell-surface glycoproteins that play key roles in the immune responses

  • B7 mRNA was detected in T cDNAs using the polymerase chain reaction (PCR)' and oliand B cell lines and in macrophage-likecell lines, but gonucleotide primers thatrecognize highly conserved integrin not eral in T

  • Thneovel cDNA is predicted to encode a 97-amino acid fragment of an integrin /3 subunit, designated p7,that is 40-61% identical to the corresponding fragments of the six previouslysequenced /3 subunits.We amplified similar partial cDNAs that presumablyencode the Integrins are a family of heterodimeric cell-surface glycoproteins that mediate adhesion of cells to other cells and to extracellular matrix [1].Leukocytes express a variety of inmouse and rabbithomologs of pi from mouse lymphocyteand macrophage-like lines (WR2.3 and P388D1) and from rabbit leukocytes obtained by bronchoalveolar lavage (>go% macrophages)

Read more

Summary

RESULTS

Thesequence of the GC-richregion beginning a t nucleotide 341 andending at nucleotide 370 could not be determined unambiguously with T 7 DNA polymerase and the standard dGTPcontaining sequencing reagent mixture. Both DNA strands were sequenced with Taq polymerase (TaqTrack, Promega Biotec)and with T7 DNA polymerase plus a deoxyinosine triphosphate-contain-. 92% of the cDNA sequence and independent hybridizing clones from each library (Fig. 1). 100% of the sequence of thepredictedopenreadingframe were obtained from both strands of DNA. 100% of the sequence of thepredictedopenreadingframe were obtained from two or more independent clones (see Fig. 1). Human leukocyte lines employedwere HUT78 T cells (ATCC TIB 161),Raji Burkitt lymphomacells (ATCC CCL 86),EBV-B6.1EBV-trans-

Apa I
Arrowheads represent oligonucleotide primers used to obtain internal
PI IIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK
Alternative splice
DISCUSSION
Other investigators have described integrin subunits that
Full Text
Published version (Free)

Talk to us

Join us for a 30 min session where you can share your feedback and ask us any queries you have

Schedule a call