Abstract
Several typographical errors were introduced into the 178HA peptide sequence during printing. The sequence is the same as the DP-178 peptide, with the addition of a GGG linker and the HA epitope at the C-terminus. The correct sequence for this peptide is: YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF GGGYPYDVPDYAGPG.
Talk to us
Join us for a 30 min session where you can share your feedback and ask us any queries you have
Disclaimer: All third-party content on this website/platform is and will remain the property of their respective owners and is provided on "as is" basis without any warranties, express or implied. Use of third-party content does not indicate any affiliation, sponsorship with or endorsement by them. Any references to third-party content is to identify the corresponding services and shall be considered fair use under The CopyrightLaw.