Abstract
The peptide toxin GsAF II (Kappa-theraphotoxin-Gr2c) is a 31-amino acid peptide, recently isolated from the venom of the tarantula spider Grammostola rosea. The peptide toxin ProTX II (β/ω-therapho...
Highlights
The peptide toxin GsAF II is a 31-amino acid peptide, recently isolated from the venom of the tarantula spider Grammostola rosea
Expression of GST-YC1 in E. coli SHuffleTM YC1 is similar to ProTX II and GsAF II in that they all have three pairs of disulfide bonds
The SUMO-YC1 fusion protein was expressed in SHuffleTM (Figure 2, lane 2), and no inclusion bodies were observed after sonication (Figure 2, lanes 3 and 4)
Summary
The peptide toxin GsAF II is a 31-amino acid peptide, recently isolated from the venom of the tarantula spider Grammostola rosea. GsAF II modifies gating in voltage-gated Na+ channels, and it has the following amino acid sequence: YCQKWMWTCDEERKCCEGLVCRLWCKKKIEW (Ono, Kimura, & Kubo, 2011). Hui Wu is presently perusing PhD in biomedical engineering from School of Research Center of Biological Information, College of Science, National University of Defense. Wu is presently working on protein expression and purification. Protein expression and purification are the key progress in the study and can obtain many purified and active peptide. It is more convenient and cost-effective alternative than traditional methods. Wu et al use this method to obtain the purified and large-scale preparation of toxins
Sign-in/Register to view highlights & summary Sign-in/Register to access full text options 
Talk to us
Join us for a 30 min session where you can share your feedback and ask us any queries you have
Schedule a callDisclaimer: All third-party content on this website/platform is and will remain the property of their respective owners and is provided on "as is" basis without any warranties, express or implied. Use of third-party content does not indicate any affiliation, sponsorship with or endorsement by them. Any references to third-party content is to identify the corresponding services and shall be considered fair use under The CopyrightLaw.
